spacer

EBI Dbfetch

ID   AJ278903; SV 1; linear; genomic DNA; STD; HUM; 3180 BP.
XX
AC   AJ278903;
XX
DT   25-AUG-2000 (Rel. 64, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, B*51012 allele,
DE   exons 1-7
XX
KW   HLA-B gene; HLA-B*51012 allele; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3180
RA   Cox S.T.;
RT   ;
RL   Submitted (24-AUG-2000) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T., Little A.M.;
RT   "Confirmation of HLA B*51012";
RL   Unpublished.
XX
DR   MD5; 1de702dce6836a66e730757fc0ebc642.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3180
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p"
FT                   /mol_type="genomic DNA"
FT                   /note="bone marrow donor"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..73,203..472,718..993,1569..1844,1949..2065,
FT                   2507..2539,2646..2689)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /note="allele HLA-B*51012"
FT                   /db_xref="GOA:P18464"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*51:01:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1E27"
FT                   /db_xref="PDB:1E28"
FT                   /db_xref="PDB:4MJI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P18464"
FT                   /protein_id="CAC05371.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRI
FT                   ALRYYNQSEAGSHTWQTMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRHLENGKETLQRADPPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            <1..73
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="allele HLA-B*51012"
FT   intron          74..202
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="allele HLA-B*51012"
FT   exon            203..472
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="allele HLA-B*51012"
FT   intron          473..717
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="allele HLA-B*51012"
FT   exon            718..993
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="allele HLA-B*51012"
FT   intron          994..1568
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="allele HLA-B*51012"
FT   exon            1569..1844
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="allele HLA-B*51012"
FT   intron          1845..1948
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="allele HLA-B*51012"
FT   exon            1949..2065
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="allele HLA-B*51012"
FT   intron          2066..2506
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="allele HLA-B*51012"
FT   exon            2507..2539
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="allele HLA-B*51012"
FT   intron          2540..2645
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="allele HLA-B*51012"
FT   exon            2646..2689
FT                   /gene="HLA-B"
FT                   /number=7
FT                   /note="allele HLA-B*51012"
XX
SQ   Sequence 3180 BP; 600 A; 909 C; 1002 G; 669 T; 0 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ccggtgagtg cggggtcggg agggaaatgg cctctgtggg gaggagcgag       120
     gggaccgcag gcgggggcgc aggacctgag gagccgcgcc gggaggaggg tcgggcgggt       180
     ctcagcccct cctcgccccc aggctcccac tccatgaggt atttctacac cgccatgtcc       240
     cggcccggcc gcggggagcc ccgcttcatc gcagtgggct acgtggacga cacccagttc       300
     gtgaggttcg acagcgacgc cgcgagtccg aggacggagc cccgggcgcc atggatagag       360
     caggaggggc cggagtattg ggaccggaac acacagatct tcaagaccaa cacacagact       420
     taccgagaga acctgcggat cgcgctccgc tactacaacc agagcgaggc cggtgagtga       480
     ccccggcccg gggcgcaggt cacgactccc catcccccac gtacggcccg ggtcgccccg       540
     agtctccggg tccgagatcc gcctccctga ggccgcggga cccgcccaga ccctcgaccg       600
     gcgagagccc caggcgcgtt tacccggttt cattttcagt tgaggccaaa atccccgcgg       660
     gttggtcggg gcggggcggg gctcggggga cggtgctgac cgcggggccg gggccagggt       720
     ctcacacttg gcagacgatg tatggctgcg acgtggggcc ggacgggcgc ctcctccgcg       780
     ggcataacca gtacgcctac gacggcaaag attacatcgc cctgaacgag gacctgagct       840
     cctggaccgc ggcggacacc gcggctcaga tcacccagcg caagtgggag gcggcccgtg       900
     aggcggagca gctgagagcc tacctggagg gcctgtgcgt ggagtggctc cgcagacacc       960
     tggagaacgg gaaggagacg ctgcagcgcg cgggtaccag gggcagtggg gagccttccc      1020
     catctcctat aggtcgccgg ggatggcctc ccacgagaag aggaggaaaa tgggatcagc      1080
     gctagaatgt cgccctccct tgaatggaga atggcatgag ttttcctgag tttcctctga      1140
     gggccccctc ttctctctag gacaattaag ggatgacgtc tctgaggaaa tggaggggaa      1200
     gacagtccct agaatactga tcaggggtcc cctttgaccc ctgcagcagc cttgggaacc      1260
     gtgacttttc ctctcaggcc ttgttctctg cctcacactc agtgtgtttg gggctctgat      1320
     tccagcactt ctgagtcact ttacctccac tcagatcagg agcagaagtc cctgttcccc      1380
     gctcagagac tcgaactttc caatgaatag gagattatcc caggtgcctg cgtccaggct      1440
     ggtgtctggg ttctgtgccc cttccccaca ccaggtgtcc tgtccattct caggctggtc      1500
     acatgggtgg tcctagggtg tcccatgaga gatgcaaagc gcctgaattt tctgactctt      1560
     cccatcagac cccccaaaga cacacgtgac ccaccacccc gtctctgacc atgaggccac      1620
     cctgaggtgc tgggccctgg gcttctaccc tgcggagatc acactgacct ggcagcggga      1680
     tggcgaggac caaactcagg acactgagct tgtggagacc agaccagcag gagatagaac      1740
     cttccagaag tgggcagctg tggtggtgcc ttctggagaa gagcagagat acacatgcca      1800
     tgtacagcat gaggggctgc cgaagcccct caccctgaga tggggtaagg agggggatga      1860
     ggggtcatat ctcttctcag ggaaagcagg agcccttctg gagcccttca gcagggtcag      1920
     ggcccctcgt cttcccctcc tttcccagag ccatcttccc agtccaccat ccccatcgtg      1980
     ggcattgttg ctggcctggc tgtcctagca gttgtggtca tcggagctgt ggtcgctact      2040
     gtgatgtgta ggaggaagag ctcaggtagg gaaggggtga ggggtggggt ctgggttttc      2100
     ttgtcccact gggggtttca agccccaggt agaagtgttc cctgcctcat tactgggaag      2160
     cagcatccac acaggggcta acgcagcctg ggaccctgtg tgccagcact tactcttttg      2220
     tgcagcacat gtgacaatga aggacggatg tatcaccttg atggttgtgg tgttggggtc      2280
     ctgatttcag cattcatgag tcaggggaag gtccctgcta aggacagacc ttaggagggc      2340
     agttggtcca ggacccacac ttgctttcct cgtgtttcct gatcctgcct tgggtctgta      2400
     gtcatacttc tggaaattcc ttttgggtcc aagacgagga ggttcctcta agatctcatg      2460
     gccctgcttc ctcccagtcc cctcacagga cattttcttc ccacaggtgg aaaaggaggg      2520
     agctactctc aggctgcgtg taagtggtgg gggtgggagt gtggaggagc tcacccaccc      2580
     cataattcct cctgtcccac gtctcctgcg ggctctgacc aggtcctgtt tttgttctac      2640
     tccagccagc gacagtgccc agggctctga tgtgtctctc acagcttgaa aaggtgagat      2700
     tcttggggtc tagagtgggc ggggggggcg gggagggggc agaggggaaa ggcctgggta      2760
     atggagattc tttgattggg atgtttcgcg tgtgtcgtgg gctgttcaga gtgtcatcac      2820
     ttaccatgac taaccagaat ttgttcatga ctgttgtttt ctgtagcctg agacagctgt      2880
     cttgtgaggg actgagatgc aggatttctt cactcctccc ctttgtgact tcaagagcct      2940
     ctggcatctc tttctgcaaa ggcacctgaa tgtgtctgcg tccctgttag cataatgtga      3000
     ggaggtggag agacagccca cccttgtgtc cactgtgacc cctgttcgca tgctgacctg      3060
     tgtttcctcc ccagaagctt gcggaagggc gaattccagc acactggcgg ccgttactag      3120
     tggatccgag ctcggtacca agcttgatgc aagcttgagt attctaacgc gtcaccttaa      3180
//


spacer
spacer