spacer

EBI Dbfetch

ID   AJ278766; SV 1; linear; genomic DNA; STD; HUM; 918 BP.
XX
AC   AJ278766;
XX
DT   03-AUG-2000 (Rel. 64, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-B gene for MHC Class I antigen, B*44MP null
DE   allele, exons 2-3
XX
KW   HLA-B gene; human leucocyte antigen B; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-918
RA   Guttridge M.G.;
RT   ;
RL   Submitted (02-AUG-2000) to the INSDC.
RL   Guttridge M.G., Tissue Typing, Welsh Blood Service, Ely Valley Road, Talbot
RL   Green, Pontyclun, Cardiff, CF72 9WB, UNITED KINGDOM.
XX
RN   [2]
RA   Guttridge M.G., Street J., Ogilvie H., Darke C.;
RT   "Identification and sequence of a new HLA-B*44 null allele";
RL   Unpublished.
XX
DR   MD5; d303e658af1213f975fda8878e9f8a3f.
DR   Ensembl-Gn; ENSG00000224608; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228964; homo_sapiens.
DR   Ensembl-Tr; ENST00000421349; homo_sapiens.
DR   Ensembl-Tr; ENST00000430299; homo_sapiens.
DR   Ensembl-Tr; ENST00000435618; homo_sapiens.
DR   Ensembl-Tr; ENST00000445610; homo_sapiens.
DR   Ensembl-Tr; ENST00000481283; homo_sapiens.
DR   Ensembl-Tr; ENST00000498484; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..918
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="12506397"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<130..399,643..918)
FT                   /gene="HLA-B*"
FT                   /product="MHC Class I antigen"
FT   CDS             join(<130..399,643..794)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC Class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="null allele B*44MP, premature stop codon at bases
FT                   792 to 794"
FT                   /db_xref="GOA:Q9MY59"
FT                   /db_xref="IMGT/HLA:B*44:23N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MY59"
FT                   /protein_id="CAC01612.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGP
FT                   DGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAA"
FT   exon            <130..399
FT                   /gene="HLA-B"
FT                   /number=2
FT   intron          400..642
FT                   /gene="HLA-B"
FT                   /number=2
FT   exon            643..918
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 918 BP; 162 A; 298 C; 344 G; 114 T; 0 other;
     gtgagtgcgg ggtcgggagg gaaatggcct ctgtggggag gagagagggg accgcaggcg        60
     ggggcgcagg acccggggag ccgcgccggg aggagggtcg ggcgggtctc agcccctcct       120
     cgcccccagg ctcccactcc atgaggtatt tctacaccgc catgtcccgg cccggccgcg       180
     gggagccccg cttcatcacc gtgggctacg tggacgacac gctgttcgtg aggttcgaca       240
     gcgacgccac gagtccgagg aaggagccgc gggcgccatg gatagagcag gaggggccgg       300
     agtattggga ccgggagaca cagatctcca agaccaacac acagacttac cgagagaacc       360
     tgcgcaccgc gctccgctac tacaaccaga gcgaggccgg tgagtgaccc cggcccgggg       420
     cgcaggtcac gactccccat cccccacgta cggcccgggt cgccccgagt ctccgggtcc       480
     gagatccgcc cccgaggccg cgggacccgc ccagaccctc gaccggcgag agccccaggc       540
     gcgtttaccc ggtttcattt tcagttgagg ccaaaatccc cgcgggttgg tcggggcggg       600
     gcggggctcg ggggacgggg ctgaccgcgg ggccggggcc agggtctcac atcatccaga       660
     ggatgtacgg ctgcgacgtg gggccggacg ggcgcctcct ccgcgggtat gaccaggacg       720
     cctacgacgg caaggattac atcgccctga acgaggacct gagctcctgg accgcggcgg       780
     acaccgcggc ttagatcacc cagcgcaagt gggaggcggc ccgtgtggcg gagcaggaca       840
     gagcctacct ggagggcctg tgcgtggagt cgctccgcag atacctggag aacgggaagg       900
     agacgctgca gcgcgcgg                                                     918
//


spacer
spacer