Dbfetch

ID   AJ278746; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ278746;
XX
DT   04-AUG-2000 (Rel. 64, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens partial HLA-B*35SRE variant for MHC Class I antigen, alpha 1
DE   domain, exon 2 and joined CDS
XX
KW   alpha 1 domain; HLA-B*35SRE gene; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Blasczyk R.;
RT   ;
RL   Submitted (27-JUL-2000) to the INSDC.
RL   Blasczyk R., Department of Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [2]
RX   DOI; 10.1038/sj.gene.6363981.
RX   PUBMED; 12944976.
RA   Elsner H.A., Baengeroth K., Blasczyk R.;
RT   "The nature of introns 4-6 suggests reduced lineage specificity in HLA-B
RT   alleles";
RL   Genes Immun. 4(6):391-401(2003).
XX
DR   MD5; 24dd5cdbd1d646aa2b82187e39f3f361.
XX
CC   Related sequences: AJ278747.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="MHH999711"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /cell_type="Blood lymphocytes"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,AJ278747.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-B*35SRE"
FT                   /product="MHC Class I antigen, alpha 1 domain"
FT                   /function="antigen presenting molecule"
FT                   /note="HLA-B*35 variant B*35SRE"
FT                   /db_xref="IMGT/HLA:B*35:65Q"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q9GJF3"
FT                   /protein_id="CAC01695.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGP
FT                   DGRLLRGHDQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLW
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B*35SRE"
FT                   /number=2
XX
SQ   Sequence 270 BP; 60 A; 88 C; 86 G; 36 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//