Dbfetch

ID   AJ278305; SV 2; linear; genomic DNA; STD; HUM; 3089 BP.
XX
AC   AJ278305;
XX
DT   03-JUN-2000 (Rel. 63, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens HLA-A*0101 gene for MHC class I antigen, exons 1-8
XX
KW   HLA-A*0101 gene; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Waller M.J.;
RT   ;
RL   Submitted (30-MAY-2000) to the INSDC.
RL   Waller M.J., HLA Informatics Group, The Anthony Nolan Research Institute,
RL   Royal Free Hospital, Pond St, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Waller M.J., Robinson J., Marsh S.G.E.;
RT   ;
RL   Unpublished.
XX
RN   [3]
RP   1-3089
RA   Waller M.J.;
RT   ;
RL   Submitted (13-JAN-2006) to the INSDC.
RL   Waller M.J., HLA Informatics Group, The Anthony Nolan Research Institute,
RL   Royal Free Hospital, Pond St, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
DR   MD5; a3a0b1a2b1c93509fc4e70f371082bff.
DR   Ensembl-Gn; ENSG00000224320; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229215; homo_sapiens.
DR   Ensembl-Tr; ENST00000431930; homo_sapiens.
DR   Ensembl-Tr; ENST00000443552; homo_sapiens.
DR   Ensembl-Tr; ENST00000549869; homo_sapiens.
DR   Ensembl-Tr; ENST00000552193; homo_sapiens.
DR   EuropePMC; PMC2686596; 18838392.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3089
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="MOLT4 & LCL721"
FT                   /cell_type="T all cell line /B lymphoblastoid cell line"
FT                   /db_xref="taxon:9606"
FT   5'UTR           <1..15
FT                   /gene="HLA-A*0101"
FT   mRNA            join(<16..88,219..488,730..1005,1585..1860,1963..2079,
FT                   2522..2554,2697..2744,2859..>2863)
FT                   /gene="HLA-A*0101"
FT                   /product="MHC class I antigen"
FT   CDS             join(16..88,219..488,730..1005,1585..1860,1963..2079,
FT                   2522..2554,2697..2744,2859..2863)
FT                   /gene="HLA-A*0101"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P30443"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*01:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1W72"
FT                   /db_xref="PDB:3BO8"
FT                   /db_xref="PDB:4NQV"
FT                   /db_xref="PDB:4NQX"
FT                   /db_xref="PDB:5BRZ"
FT                   /db_xref="PDB:5BS0"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30443"
FT                   /protein_id="CAB93537.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGT
FT                   LRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYTQAASSDSAQGSDVSLTACKV"
FT   sig_peptide     16..87
FT                   /gene="HLA-A*0101"
FT   exon            16..88
FT                   /gene="HLA-A*0101"
FT                   /number=1
FT   mat_peptide     join(88..88,219..488,730..1005,1585..1860,1963..2079,
FT                   2522..2554,2697..2744,2859..2863)
FT                   /gene="HLA-A*0101"
FT                   /product="MHC class I antigen"
FT   intron          89..218
FT                   /gene="HLA-A*0101"
FT                   /number=1
FT   exon            219..488
FT                   /gene="HLA-A*0101"
FT                   /number=2
FT   intron          489..729
FT                   /gene="HLA-A*0101"
FT                   /number=2
FT   exon            730..1005
FT                   /gene="HLA-A*0101"
FT                   /number=3
FT   intron          1006..1584
FT                   /gene="HLA-A*0101"
FT                   /number=3
FT   exon            1585..1860
FT                   /gene="HLA-A*0101"
FT                   /number=4
FT   intron          1861..1962
FT                   /gene="HLA-A*0101"
FT                   /number=4
FT   exon            1963..2079
FT                   /gene="HLA-A*0101"
FT                   /number=5
FT   intron          2080..2521
FT                   /gene="HLA-A*0101"
FT                   /number=5
FT   exon            2522..2554
FT                   /gene="HLA-A*0101"
FT                   /number=6
FT   intron          2555..2696
FT                   /gene="HLA-A*0101"
FT                   /number=6
FT   exon            2697..2744
FT                   /gene="HLA-A*0101"
FT                   /number=7
FT   intron          2745..2858
FT                   /gene="HLA-A*0101"
FT                   /number=7
FT   exon            2859..2863
FT                   /gene="HLA-A*0101"
FT                   /number=8
FT   3'UTR           2864..>3089
FT                   /gene="HLA-A*0101"
XX
SQ   Sequence 3089 BP; 594 A; 880 C; 964 G; 651 T; 0 other;
     ccccagacgc cgaggatggc cgtcatggcg ccccgaaccc tcctcctgct actctcgggg        60
     gccctggccc tgacccagac ctgggcgggt gagtgcgggg tcgggaggga aaccgcctct       120
     gcggggagaa gcaaggggcc ctcctggcgg gggcgcagga ccgggggagc cgcgccggga       180
     ggagggtcgg gcaggtctca gccactgctc gcccccaggc tcccactcca tgaggtattt       240
     cttcacatcc gtgtcccggc ccggccgcgg ggagccccgc ttcatcgccg tgggctacgt       300
     ggacgacacg cagttcgtgc ggttcgacag cgacgccgcg agccagaaga tggagccgcg       360
     ggcgccgtgg atagagcagg aggggccgga gtattgggac caggagacac ggaatatgaa       420
     ggcccactca cagactgacc gagcgaacct ggggaccctg cgcggctact acaaccagag       480
     cgaggacggt gagtgacccc ggcccggggc gcaggtcacg acccctcatc ccccacggac       540
     gggccaggtc gcccacagtc tccgggtccg agatccaccc cgaagccgcg ggactccgag       600
     acccttgtcc cgggagaggc ccaggcgcct ttacccggtt tcattttcag tttaggccaa       660
     aaatcccccc gggttggtcg gggcggggcg gggctcgggg gactgggctg accgcggggt       720
     cggggccagg ttctcacacc atccagataa tgtatggctg cgacgtgggg ccggacgggc       780
     gcttcctccg cgggtaccgg caggacgcct acgacggcaa ggattacatc gccctgaacg       840
     aggacctgcg ctcttggacc gcggcggaca tggcagctca gatcaccaag cgcaagtggg       900
     aggcggtcca tgcggcggag cagcggagag tctacctgga gggccggtgc gtggacgggc       960
     tccgcagata cctggagaac gggaaggaga cgctgcagcg cacgggtacc aggggccacg      1020
     gggcgcctcc ctgatcgcct atagatctcc cgggctggcc tcccacaagg aggggagaca      1080
     attgggacca acactagaat atcaccctcc ctctggtcct gagggagagg aatcctcctg      1140
     ggtttccaga tcctgtacca gagagtgact ctgaggttcc gccctgctct ctgacacaat      1200
     taagggataa aatctctgaa ggagtgacgg gaagacgatc cctcgaatac tgatgagtgg      1260
     ttccctttga caccggcagc agccttgggc ccgtgacttt tcctctcagg ccttgttctc      1320
     tgcttcacac tcaatgtgtg tgggggtctg agtccagcac ttctgagtct ctcagcctcc      1380
     actcaggtca ggaccagaag tcgctgttcc cttctcaggg aatagaagat tatcccaggt      1440
     gcctgtgtcc aggctggtgt ctgggttctg tgctctcttc cccatcccgg gtgtcctgtc      1500
     cattctcaag atggccacat gcgtgctggt ggagtgtccc atgacagatg caaaatgcct      1560
     gaattttctg actcttcccg tcagaccccc ccaagacaca tatgacccac caccccatct      1620
     ctgaccatga ggccaccctg aggtgctggg ccctgggctt ctaccctgcg gagatcacac      1680
     tgacctggca gcgggatggg gaggaccaga cccaggacac ggagctcgtg gagaccaggc      1740
     ctgcagggga tggaaccttc cagaagtggg cggctgtggt ggtgccttct ggagaggagc      1800
     agagatacac ctgccatgtg cagcatgagg gtctgcccaa gcccctcacc ctgagatggg      1860
     gtaaggaggg agatgggggt gtcatgtctc ttagggaaag caggagcctc tctggagacc      1920
     tttagcaggg tcagggcccc tcaccttccc ctcttttccc agagctgtct tcccagccca      1980
     ccatccccat cgtgggcatc attgctggcc tggttctcct tggagctgtg atcactggag      2040
     ctgtggtcgc tgccgtgatg tggaggagga agagctcagg tggagaaggg gtgaagggtg      2100
     gggtctgaga tttcttgtct cactgagggt tccaagcccc agctagaaat gtgccctgtc      2160
     tcattactgg gaagcacctt ccacaatcat gggccgaccc agcctgggcc ctgtgtgcca      2220
     gcacttactc ttttgtaaag cacctgttaa aatgaaggac agatttatca ccttgattac      2280
     ggcggtgatg ggacctgatc ccagcagtca caagtcacag gggaaggtcc ctgaggacag      2340
     acctcaggag ggctattggt ccaggaccca cacctgcttt cttcatgttt cctgatcccg      2400
     ccctgggtct gcagtcacac atttctggaa acttctctgg ggtccaagac taggaggttc      2460
     ctctaggacc ttaaggccct ggctcctttc tggtatctca caggacattt tcttcccaca      2520
     gatagaaaag gagggagtta cactcaggct gcaagtaagt atgaaggagg ctgatgcctg      2580
     aggtccttgg gatattgtgt ttgggagccc atgggggagc tcacccaccc cacaattcct      2640
     cctctagcca catcttctgt gggatctgac caggttctgt ttttgttcta ccccaggcag      2700
     tgacagtgcc cagggctctg atgtgtctct cacagcttgt aaaggtgaga gcttggaggg      2760
     cctgatgtgt gttgggtgtt gggtggaaca gtggacacag ctgtgctatg gggtttcttt      2820
     gcgttggatg tattgagcat gcgatgggct gtttaaggtg tgacccctca ctgtgatgga      2880
     tatgaatttg ttcatgaata tttttttcta tagtgtgaga cagctgcctt gtgtgggact      2940
     gagaggcaag agttgttcct gcccttccct ttgtgacttg aagaaccctg actttgtttc      3000
     tgcaaaggca cctgcatgtg tctgtgttcg tgtaggcata atgtgaggag gtggggagag      3060
     caccccaccc ccatgtccac catgaccct                                        3089
//