spacer

EBI Dbfetch

ID   AJ277100; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ277100;
XX
DT   04-APR-2000 (Rel. 63, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen Cw*0602 allele,
DE   exon 2 and joined CDS
XX
KW   HLA-C gene; HLA-Cw*0602 allele; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Dunn P.P.;
RT   ;
RL   Submitted (28-MAR-2000) to the INSDC.
RL   Dunn P.P., Immunogenetics, UKTSSA, Fox Den Road, Stoke Gifford, Bristol,
RL   BS34 8RR, UNITED KINGDOM.
XX
RN   [2]
RA   Dunn P.P., Hamer J., Harvey J., Green A.;
RT   "Nucleotide sequence of a Cw*0602 variant allele";
RL   Unpublished.
XX
DR   MD5; d9e97fd8118b6226fcfff708afe2d754.
XX
CC   Related sequences: AJ277101, AJ277102, AJ277103
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,AJ277101.1:1..276,AJ277102.1:1..276,
FT                   AJ277103.1:1..>120)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /standard_name="MHC class I antigen"
FT                   /product="human leucocyte antigen C"
FT                   /note="Cw*0602 allele"
FT                   /db_xref="GOA:Q9MY41"
FT                   /db_xref="IMGT/HLA:C*06:06"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MY41"
FT                   /protein_id="CAB86064.1"
FT                   /translation="SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEDGSHTLQWMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTI
FT                   PIVGIVAGLAVLAVLAVLGAVMAVVMCRRKSS"
FT   exon            <1..270
FT                   /gene="HLA-C"
FT                   /number=2
FT                   /note="Cw*0602 allele"
XX
SQ   Sequence 270 BP; 55 A; 83 C; 98 G; 34 T; 0 other;
     gctcccactc catgaggtat ttcgacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccc cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggacg                                        270
//


spacer
spacer