spacer

EBI Dbfetch

ID   AJ276994; SV 1; linear; genomic DNA; STD; HUM; 546 BP.
XX
AC   AJ276994;
XX
DT   04-APR-2000 (Rel. 63, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-B gene MHC class I antigen, HLA-B*08 new allele
XX
KW   HLA-B gene; HLA-B*08 new allele; human leucocyte antigen B;
KW   major histocompatibilty complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RA   Anholts J.D.H.;
RT   ;
RL   Submitted (30-MAR-2000) to the INSDC.
RL   Anholts J.D.H., Immunohematology and Bloodbank, Leids Universitair Medisch
RL   Centrum, Albinusdreef 2, 2333 AA Leiden, NETHERLANDS.
XX
RN   [2]
RX   DOI; 10.1034/j.1399-0039.2001.580107.x.
RX   PUBMED; 11580855.
RA   Anholts J.D.H., Kemps-Mols B., Verduijn W., Oudshoorn M., Schreuder G.M.T.;
RT   "Three newly identified HLA-B alleles: B*5124, B*5306, B*5307 and
RT   confirmation of B*0809 and B*5606";
RL   Tissue Antigens 58(1):38-41(2001).
XX
DR   MD5; 51c56ed20c16aecb0b91206a1717fe7d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leucocytee"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>544
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /standard_name="MHC class I antigen"
FT                   /product="human leucocyte antigen B"
FT                   /function="antigen presenting molecule"
FT                   /note="HLA-B*08 new allele"
FT                   /db_xref="GOA:Q7JGR8"
FT                   /db_xref="IMGT/HLA:B*08:09"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q7JGR8"
FT                   /protein_id="CAB86195.1"
FT                   /translation="SHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTWQTMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTC
FT                   VEWLRRYLENGKDTLERA"
XX
SQ   Sequence 546 BP; 114 A; 169 C; 193 G; 70 T; 0 other;
     gctcccactc catgaggtat ttcgacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacac ttggcagacg atgtatggct       300
     gcgacgtggg gccggacggg cgcctcctcc gcgggcataa ccagtacgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctgc gctcctggac cgcggcggac accgcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcaggacaga gcctacctgg       480
     agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggac acgctggagc       540
     gcgcgg                                                                  546
//


spacer
spacer