Dbfetch

ID   AJ269496; SV 1; linear; genomic DNA; STD; HUM; 269 BP.
XX
AC   AJ269496;
XX
DT   03-JUL-2000 (Rel. 64, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens partial HLA-B gene MHC class I antigen (HLA-B*49 new allele),
DE   exon 2 and joined CDS
XX
KW   HLA-B gene; human leucocyte antigen B; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-269
RA   Poli F.;
RT   ;
RL   Submitted (03-APR-2000) to the INSDC.
RL   Poli F., Centro Trasfusionale e di Immunologia dei Trapianti, Ospedale
RL   Maggiore Policlinico di Milano, Via Francesco Sforza, 35 - Milano, 20122,
RL   ITALY.
XX
RN   [2]
RX   DOI; 10.1034/j.1399-0039.2001.057002173.x.
RX   PUBMED; 11260516.
RA   Poli F., Longhi E., Frison S., Scalamogna M., Crespiatico L., Bianchi P.,
RA   Sirchia G.;
RT   "Identification of a novel HLA-B allele--HLA-B*4902";
RL   Tissue Antigens 57(2):173-174(2001).
XX
DR   MD5; 26d091c49104b6e54cb662a1cc75e182.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..269
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p"
FT                   /mol_type="genomic DNA"
FT                   /sex="female"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..269,AJ269497.1:1..277,AJ269498.1:1..>266)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /standard_name="MHC class I antigen"
FT                   /product="human leucocyte antigen B"
FT                   /function="antigen presenting molecule"
FT                   /note="B*49 new allele"
FT                   /db_xref="IMGT/HLA:B*49:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MY68"
FT                   /protein_id="CAB96182.1"
FT                   /translation="SHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHTWQRMYGCDLGP
FT                   DGRLLRGYNQLAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLT"
FT   exon            1..269
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*49 new allele"
XX
SQ   Sequence 269 BP; 60 A; 90 C; 84 G; 35 T; 0 other;
     gctcccactc catgaggtat ttccacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac ctgcgcaccg       240
     cgctccgcta ctacaaccag agcgaggcc                                         269
//