spacer

EBI Dbfetch

ID   AJ251768; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ251768;
XX
DT   09-JUN-2000 (Rel. 64, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, B*3903 variant
DE   allele, exon 2 and joined CDS
XX
KW   HLA-B gene; human leucocyte antigen B; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Middleton D.T.;
RT   ;
RL   Submitted (08-DEC-1999) to the INSDC.
RL   Middleton D.T., Tissue Typing Laboratory, Belfast City Hospital, Blood
RL   Transfusion Building, City Hospital, Belfast, BT9 7TS, UNITED KINGDOM.
XX
RN   [3]
RX   DOI; 10.1034/j.1399-0039.2000.560411.x.
RX   PUBMED; 11098939.
RA   Williams F., Curran M.D., Leheny W.A., Daar A.S., Middleton D.T.C.;
RT   "Characterization of HLA-B*3921 and confirmation of HLA-B*4415, two variant
RT   HLA-B alleles identified in the Omani population";
RL   Tissue Antigens 56(4):376-379(2000).
XX
DR   MD5; 71acc7f8e83fa0b231ec54056f54edea.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="chromosome 6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,AJ251769.2:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /standard_name="MHC class I antigen"
FT                   /product="human leucocyte antigen B"
FT                   /function="antigen presenting molecule"
FT                   /note="B*3903 variant allele"
FT                   /db_xref="GOA:Q9MY70"
FT                   /db_xref="IMGT/HLA:B*39:24:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MY70"
FT                   /protein_id="CAB94226.2"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQICKTNTQTDRESLRNLRGYYNQSEAGSHTLQSTYGCDVGP
FT                   DGRLLRGHNQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRTYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*3903 variant allele"
XX
SQ   Sequence 270 BP; 60 A; 85 C; 89 G; 36 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gaatattggg       180
     accggaacac acagatctgc aagaccaaca cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer