spacer

EBI Dbfetch

ID   AJ251755; SV 1; linear; genomic DNA; STD; HUM; 3097 BP.
XX
AC   AJ251755;
XX
DT   15-FEB-2000 (Rel. 62, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen (B*8202 allele), exons 1-7
XX
KW   HLA-B gene; HLA-B*8202; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Revised by author
RP   1-3097
RA   Little A.M.;
RT   ;
RL   Submitted (13-DEC-1999) to the INSDC.
RL   Little A.M., Molecular HLA, Anthony Nolan Research Institute, The RFH, Pond
RL   Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1034/j.1399-0039.2000.560216.x.
RX   PUBMED; 11019925.
RA   Cox S.T., Hossain E., McWhinnie A., Prokupek B.M., Madrigal J.A.,
RA   Little A.M.;
RT   "HLA-B*8202 identified in a Caucasoid potential bone marrow donor";
RL   Tissue Antigens 56(2):188-191(2000).
XX
DR   MD5; ef1abfd82382b7e5a0391ee0aff97564.
DR   Ensembl-Gn; ENSG00000206450; homo_sapiens.
DR   Ensembl-Tr; ENST00000359635; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3097
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,203..473,719..993,1568..1843,1948..2064,
FT                   2505..2537,2644..2687)
FT                   /gene="HLA-B"
FT                   /standard_name="MHC class I antigen"
FT                   /product="human leucocyte antigen B"
FT                   /function="antigen presentation"
FT                   /note="B*8202 allele"
FT                   /db_xref="GOA:Q29718"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*82:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29718"
FT                   /protein_id="CAB75360.1"
FT                   /translation="MRVTAPRTLLLLLWGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRN
FT                   LRGYYNQSEAGSHTLQRMFGCDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            1..73
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="B*8202 allele"
FT   intron          74..202
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="B*8202 allele"
FT   exon            203..473
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*8202 allele"
FT   intron          474..718
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*8202 allele"
FT   exon            719..993
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B*8202 allele"
FT   intron          994..1567
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B*8202 allele"
FT   exon            1568..1843
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="B*8202 allele"
FT   intron          1844..1947
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="B*8202 allele"
FT   exon            1948..2064
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="B*8202 allele"
FT   intron          2065..2504
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="B*8202 allele"
FT   exon            2505..2537
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="B*8202 allele"
FT   intron          2538..2643
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="B*8202 allele"
FT   exon            2644..2687
FT                   /gene="HLA-B"
FT                   /number=7
FT                   /note="B*8202 allele"
FT   3'UTR           2688..3097
FT                   /gene="HLA-B"
XX
SQ   Sequence 3097 BP; 572 A; 888 C; 990 G; 647 T; 0 other;
     atgcgggtca cggcaccccg aaccctcctc ctgctgctct ggggggccct ggccctgacc        60
     gagacctggg ctggtgagtg cggggtcggg agggaaatgg cctctgtggg gaggagcgag       120
     gggaccgcag gcgggggcgc aggacccggg gagccgcgcc gggaggaggg tctggcgggt       180
     ctcagcccct cctcgctccc aggctcccac tccatgaggt atttctacac cgctatgtcc       240
     cggcccggcc gcggggagcc ccgcttcatc tcagtgggct acgtggacga cacgcagttc       300
     gtgaggttcg acagcgacgc cgcgagtccg agagaggagc cgcgggcgcc gtggatagag       360
     caggaggggc cggagtattg ggaccggaac acacagatct acaaggccca ggcacagact       420
     gaccgagaga gcctgcggaa cctgcgcggc tactacaacc agagcgaggc cggtgagtga       480
     ccccggcccg gggcgcaggt cacgactccc catcccccac ggacggcccg ggtcgccccg       540
     agtctccggg tccgagatcc gccccctgag gccgcgggac ccgcccagac cctcgaccgg       600
     cgagagcccc aggcgcgttt acccggtttc attttcagtt gaggccaaaa tccccgcggg       660
     ttggtcgggg cggggcgggg ctcgggggga cggggctgac cgcgggggcg gggccagggt       720
     ctcacaccct ccagaggatg tttggctgcg acctggggcc cgacgggcgc ctcctccgcg       780
     ggcataacca gttagcctac gacggcaagg attacatcgc cctgaacgag gacctgagct       840
     cctggaccgc ggcggacacc gcggctcaga tcacccagcg caagtgggag gcggcccgtg       900
     tggcggagca ggacagagcc tacctggagg gcctgtgcgt ggagtcgctc cgcagatacc       960
     tggagaacgg gaaggagacg ctgcagcgcg cgggtaccag gggcagtggg gagccttccc      1020
     catctcctat aggtcgccgg ggatggcctc ccacgagaag aggaggaaaa tgggatcagc      1080
     gctagaatgt cgccctccct tgaatggaga atggcatgag ttttcctgag tttcctctga      1140
     gggccccctc ttctctctag gacaattaag ggatgacgtc tctgaggaaa tggaggggaa      1200
     gacagtccct agaatactga tcaggggtcc cctttgaccc ctgcagcagc cttgggaacc      1260
     gtgactttcc tctcaggcct tgttctctgc ctcacactca gtgtgtttgg ggctctgatt      1320
     ccagcacttc tgagtcactt tacctccact cagatcggga gcagaagtcc ctgttccccg      1380
     ctcagagact cgaactttcc aatgaatagg agattatccc aggtgcctgc gtccaggctg      1440
     gtgtctgggt tctgtgcccc ttccccaccc caggtgtcct gtccattctc aggctggtca      1500
     catgggtggt cctagggtgt cccatgagag atgcaaagcg cctgaatttt ctgactcttc      1560
     ccatcagacc ccccaaagac acatgtgacc caccacccca tctctgacca tgaggccacc      1620
     ctgaggtgct gggccctggg cttctaccct gcggagatca cactgacctg gcagcgggat      1680
     ggcgaggacc aaactcagga caccgagctt gtggagacca gaccagcagg agatagaacc      1740
     ttccagaagt gggcagctgt ggtggtgcct tctggagaag agcagagata cacatgccat      1800
     gtacagcatg aggggctgcc gaagcccctc accctgagat ggggtaagga gggggatgag      1860
     gggtcatatc tcttctcagg gaaagcagga gcccttctgg agcccttcag cagggtcagg      1920
     gcccctcatc ttcccctcct ttcccagagc catcttccca gtccaccatc cccatcgtgg      1980
     gcattgttgc tggcctggct gtcctagcag ttgtggtcat cggagctgtg gttgctactg      2040
     tgatgtgtag gaggaagagc tcaggtaggg aaggggtgag gggtggggtc tgggttttct      2100
     tgtcccactg ggggtttcaa gccccaggta gaagtgttcc ctgcctcatt actgggaagc      2160
     agcatccaca caggggctaa cgcagcctgg gaccctgtgt gccagcactt actcttttgt      2220
     gcagcacatg tgacaatgaa ggacggatgt atcaccttga tggttgtggt gttggggtcc      2280
     tgattccagc atcatgagtc aggggaaggt ccctgctaag gacagacctt aggagggcag      2340
     ttggtccagg acccacactt gctttcctcg tgtttcctga tcctgccttg ggtctgtagt      2400
     catacttctg gaaattcctt ttggttccaa gacgaggagg ttcctctaag atctcatggc      2460
     cctgcttcct cccagtcccc tcacaggaca ttttcttccc acaggtggaa aaggagggag      2520
     ctactctcag gctgcgtgta agtggtgggg gtgggagtgt ggaggagctc acccacccca      2580
     taattcctcc tgtcccacgt ctcctgcggg ctctgaccag gtcctgtttt tgttctactc      2640
     cagccagcga cagtgcccag ggctctgatg tgtctctcac agcttgaaaa ggtgagattc      2700
     ttggggtcta gagtgggtgg ggtggcgggt ctgggggtgg gtggggcaga ggggaaaggc      2760
     ctgggtaatg gagattcttt gattgggatg tttcgcgtgt gtggtgggct gttcagagtg      2820
     tcatcactta ccatgactaa ccagaatttg ttcatgactg ttgttttctg tagcctgaga      2880
     cagctgtctt gtgagggacc gagatgcagg atttcttcac gcctcccctt tgtgacttca      2940
     agagcctctg gcatctcttt ctgcaaaggc acctgaatgt gtctgcgtcc ctgttagcat      3000
     aatgtgagga ggtggagaga cagcccaccc ccgtgtccac cgtgacccct gttcgcatgc      3060
     tgacctgtgt ttcctcccca gaagcttgcg gaagggc                               3097
//


spacer
spacer