spacer

EBI Dbfetch

ID   AJ251541; SV 2; linear; genomic DNA; STD; HUM; 944 BP.
XX
AC   AJ251541;
XX
DT   12-DEC-1999 (Rel. 62, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-A gene for human leukocyte antigen class I, exons
DE   2-3, allele A*3305
XX
KW   HLA-A gene; HLA-A33New allele; human leukocyte antigen;
KW   major histocompatibily complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Witter K.;
RT   ;
RL   Submitted (08-DEC-1999) to the INSDC.
RL   Witter K., University of Munich, Labor of Immunogenetics, Paul Heyse
RL   Strasse 33, 80336 Munich, GERMANY.
XX
RN   [2]
RA   Witter K., Zahn R., Scholz S., Albert E.D.;
RT   "A new HLA-A33 allele results from the detection of a not yet known
RT   polymorphic position";
RL   Unpublished.
XX
RN   [3]
RP   1-944
RA   Witter K.;
RT   ;
RL   Submitted (31-JAN-2001) to the INSDC.
RL   Witter K., University of Munich, Labor of Immunogenetics, Paul Heyse
RL   Strasse 33, 80336 Munich, GERMANY.
XX
DR   MD5; c34122856baa4b62a3f0e1887200daaa.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..944
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /rearranged
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<94..363,605..>880)
FT                   /gene="HLA-A"
FT   CDS             join(<94..363,605..>880)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /product="human leukocyte antigen class I"
FT                   /function="immune recognition"
FT                   /note="allele A*3305"
FT                   /db_xref="GOA:Q9UEY0"
FT                   /db_xref="IMGT/HLA:A*33:05"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9UEY0"
FT                   /protein_id="CAB62907.2"
FT                   /translation="SHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEREGPEYWDRNTRNVKAHSQIDRVDLGTLRGYYNQSEAGSHTIQMMYGCDVGS
FT                   DGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRHLENGKETLQRT"
FT   exon            94..363
FT                   /gene="HLA-A"
FT                   /number=2
FT   variation       253
FT                   /gene="HLA-A"
FT                   /replace="a"
FT                   /note="A*3301 allele"
FT   exon            605..880
FT                   /gene="HLA-A"
FT                   /number=3
XX
SQ   Sequence 944 BP; 166 A; 308 C; 341 G; 129 T; 0 other;
     gagaagcaag gggcccgccc ggcgggggcg caggacccgg gtagccgcgc cgggaggagg        60
     gtcgggcgga tctcagccac tcctcgcccc caggctccca ctccatgagg tatttcacca       120
     catccgtgtc ccggcccggc cgcggggagc cccgcttcat cgccgtgggc tacgtggacg       180
     acacgcagtt cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc       240
     cgtggataga gcgggagggg ccggagtatt gggaccggaa cacacggaat gtgaaggccc       300
     actcacagat tgaccgagtg gacctgggga ccctgcgcgg ctactacaac cagagcgagg       360
     ccggtgagtg accccagccc ggggcgcagg tcacgacctc tcatccccca cggacgggcc       420
     aggtcaccca cagtctccgg gtccgagatc caccccgaag ccgcgggacc ccgagaccct       480
     tgccccggga gaggcccagg cgcctttacc cggtttcatt ttcagtttag gccaaaaatc       540
     cccccgggtt ggtcggggcc ggacggggct cgggggactg ggctgaccgt ggggtcgggg       600
     ccaggttctc acaccatcca gatgatgtat ggctgcgacg tggggtcgga cgggcgcttc       660
     ctccgcgggt accagcagga cgcctacgac ggcaaggatt acatcgcctt gaacgaggac       720
     ctgcgctctt ggaccgcggc ggacatggcg gctcagatca cccagcgcaa gtgggaggcg       780
     gcccgtgtgg cggagcagtt gagagcctac ctggagggca cgtgcgtgga gtggctccgc       840
     agacacctgg agaacgggaa ggagacgctg cagcgcacgg gtaccagggg ccacggggcg       900
     cctccctgat cgcctgtaga tctcccgggc tggcctccca caag                        944
//


spacer
spacer