spacer

EBI Dbfetch

ID   AJ251160; SV 1; linear; genomic DNA; STD; HUM; 814 BP.
XX
AC   AJ251160;
XX
DT   02-FEB-2000 (Rel. 62, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial MICB gene for MHC class I chain-related protein B,
DE   exons 2-3
XX
KW   MHC class I chain-related protein B; MICB gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-814
RA   Perez-Rodriguez M.E.;
RT   ;
RL   Submitted (07-DEC-1999) to the INSDC.
RL   Perez-Rodriguez M.E., Research Institute, The Anthony Nolan Bone Marrow
RL   Trust, Pond Street, Hampstead,, London NW3 2QG, UNITED KINGDOM.
XX
RN   [3]
RX   DOI; 10.1034/j.1399-0039.2000.550210.x.
RX   PUBMED; 10746790.
RA   Fischer G., Perez-Rodriguez M., Arguello R., Cox S.T., McWhinnie A.,
RA   Travers P.J., Madrigal A.;
RT   "Three novel MICB alleles";
RL   Tissue Antigens 55(2):166-170(2000).
XX
DR   MD5; 82d07028d1125a90d4a6df4e583e8507.
DR   Ensembl-Gn; ENSG00000204516; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206449; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227772; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234218; homo_sapiens.
DR   Ensembl-Gn; ENSG00000238289; homo_sapiens.
DR   Ensembl-Tr; ENST00000399150; homo_sapiens.
DR   Ensembl-Tr; ENST00000428416; homo_sapiens.
DR   Ensembl-Tr; ENST00000436531; homo_sapiens.
DR   Ensembl-Tr; ENST00000436655; homo_sapiens.
DR   Ensembl-Tr; ENST00000438954; homo_sapiens.
DR   Ensembl-Tr; ENST00000443156; homo_sapiens.
DR   IMGT/LIGM; AJ251160.
XX
CC   Related Sequences: AJ251156-AJ251161.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..814
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="A29,B61,C2,DR11,DQ7"
FT                   /cell_line="SWEIG007"
FT                   /cell_type="B-lymphoblastoid"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..255,527..814,AJ251161.1:1..279,
FT                   AJ251161.1:379..>510)
FT                   /codon_start=3
FT                   /gene="MICB"
FT                   /product="MHC class I chain-related protein B"
FT                   /function="unknown"
FT                   /db_xref="GOA:Q29980"
FT                   /db_xref="HGNC:HGNC:7091"
FT                   /db_xref="IMGT/HLA:MICB*013"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1JE6"
FT                   /db_xref="PDB:2WY3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29980"
FT                   /protein_id="CAB72098.1"
FT                   /translation="PHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKPQ
FT                   GQWAEDVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCEIHEDSSTR
FT                   GSRHFYYDGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADC
FT                   LQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSL
FT                   SHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHSTHPVPSGKALVLQS
FT                   QRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGP"
FT   exon            <1..255
FT                   /gene="MICB"
FT                   /number=2
FT   intron          256..526
FT                   /gene="MICB"
FT                   /number=2
FT   exon            527..>814
FT                   /gene="MICB"
FT                   /number=3
XX
SQ   Sequence 814 BP; 204 A; 195 C; 272 G; 143 T; 0 other;
     agccccacag tcttcgttac aacctcatgg tgctgtccca ggatggatct gtgcagtcag        60
     ggtttctcgc tgagggacat ctggatggtc agcccttcct gcgctatgac aggcagaaac       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggagctaag acctgggaca       180
     cagagaccga ggacttgaca gagaatgggc aagacctcag gaggaccctg actcatatca       240
     aggaccagaa aggaggtgag agtcggcagg ggcaagagta atgggaggcc ttctccagga       300
     aagttggaga cagagagcag ggacctgtct cttcccgctg gatctggctg ggggtgggga       360
     tgaggaatag ggtcagggag gctcagcagg gtggtgagcc ggaactcagc ccacacaggg       420
     aggcatggag gagggccagg gaggggtcgc cgctgggctg agttcctcac ttgggtggaa       480
     aggtgatggg ttcgggaatg gagaagtcac tgctgggtgg gggcaggctt gcattccctc       540
     caggagatta gggtctgtga gatccatgaa gacagcagca ccaggggctc ccggcatttc       600
     tactacgatg gggagctctt cctctcccaa aacctggaga ctcaagaatc gacagtgccc       660
     cagtcctcca gagctcagac cttggctatg aacgtcacaa atttctggaa ggaagatgcc       720
     atgaagacca agacacacta tcgcgctatg caggcagact gcctgcagaa actacagcga       780
     tatctgaaat ccggggtggc catcaggaga acag                                   814
//


spacer
spacer