spacer

EBI Dbfetch

ID   AJ250805; SV 1; linear; genomic DNA; STD; HUM; 1915 BP.
XX
AC   AJ250805;
XX
DT   03-NOV-2000 (Rel. 65, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial MICA gene for MHC class I chain-related protein A,
DE   exons 2-5, cell line DO208915
XX
KW   MHC class I chain-related protein A; MICA gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1915
RA   Perez-Rodriguez M.E.;
RT   ;
RL   Submitted (03-NOV-1999) to the INSDC.
RL   Perez-Rodriguez M.E., Research Institute, The Anthony Nolan Bone Marrow
RL   Trust, Pond Street, Hampstead,, London NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1046/j.0960-7420.2001.00275.x.
RX   PUBMED; 11841487.
RA   Perez-Rodriguez M., Arguello R., Fischer G., Corell A., Cox S.T.,
RA   Robinson J., Hossain E., McWhinnie A., Travers P.J., Marsh S.G.E.,
RA   Madrigal J.A.;
RT   "Further polymorphism of the MICA gene";
RL   Eur. J. Immunogenet. 29(1):35-46(2002).
XX
DR   MD5; 2222aa951d37a314f0534a11712a511b.
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; AJ250805.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1915
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="A25,B18,DR15,DQ6"
FT                   /cell_line="DO208915"
FT                   /cell_type="B-lymphoblastoid"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(1..255,530..817,1405..1683,1784..1915)
FT                   /gene="MICA"
FT   CDS             join(<1..255,530..817,1405..1683,1784..>1915)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /product="MHC class I chain-related protein A"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="IMGT/HLA:MICA*018:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29983"
FT                   /protein_id="CAC15383.1"
FT                   /translation="PHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQS
FT                   HWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGP"
FT   exon            1..255
FT                   /gene="MICA"
FT                   /number=2
FT   intron          256..529
FT                   /gene="MICA"
FT                   /number=2
FT   exon            530..817
FT                   /gene="MICA"
FT                   /number=3
FT   intron          818..1404
FT                   /gene="MICA"
FT                   /number=3
FT   exon            1405..1683
FT                   /gene="MICA"
FT                   /number=4
FT   intron          1684..1783
FT                   /gene="MICA"
FT                   /number=4
FT   exon            1784..1915
FT                   /gene="MICA"
FT                   /number=5
XX
SQ   Sequence 1915 BP; 437 A; 506 C; 576 G; 396 T; 0 other;
     agccccacag tcttcgttat aacctcacgg tgctgtcctg ggatggatct gtgcagtcag        60
     ggtttctcac tgaggtacat ctggatggtc agcccttcct gcgctgtgac aggcagaaat       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggaaataag acatgggaca       180
     gagagaccag agacttgaca gggaacggaa aggacctcag gatgaccctg gctcatatca       240
     aggaccagaa agaaggtgag agtcggcagg ggcaagagtg actggagagg ccttttccag       300
     aaaagttagg ggcagagagc agggacctgt ctcttcccac tggatctggc tcaggctggg       360
     ggtgaggaat gggggtcagt ggaactcagc agggtggtga gccggcactc agcccacaca       420
     gggaggcatg gaggagggcc agggaggcgt accccctggg ctgagttcct cacttgggtg       480
     gaaaggtgat gggttcggga atggagaagt cactgctggg tgggggcagg cttgcattcc       540
     ctccaggaga ttagggtctg tgagatccat gaagacaaca gcaccaggag ctcccagcat       600
     ttctactacg atggggagct cttcctctcc caaaacctgg agactgagga atggacaatg       660
     ccccagtcct ccagagctca gaccttggcc atgaacgtca ggaatttctt gaaggaagat       720
     gccatgaaga ccaagacaca ctatcacgct atgcatgcag actgcctgca ggaactacgg       780
     cgatatctaa aatccggcgt agtcctgagg agaacaggta ccgacgctgg ccaggggctc       840
     tcctctccct ccaattctgc tagagttgcc tcacctccca gatgtgtcca gggaaaccct       900
     ccctgtgcta tggatgaagg catttcctgt tggcacatcg tgtcctgatt ttcctctatt       960
     gttagagcca ctggataaag acagtgggtc agggactgga ccatccagtg ttgtaatcag      1020
     ggcaagtaga ggaccctccg acagaatcct gagcctgggg tgggtgtcag gcaggagagg      1080
     aaggcttcag ggccagggct gccccctctg cctcccagcc tgcccatcct ggagagttcc      1140
     ctcctggccc cacaacccag gagtccaccc ctgacatccc cctcctcagc atcaatgtgg      1200
     ggatcccaga gcctgaggcc acagtcccat ggcccatcct cctgccagcc tggaagaact      1260
     gggccccaga gtgaggacag acttgcaggt caggggtccc agagggcttc agccagagtg      1320
     agaacagtga agagaaacag ccctgttcct ctcccctcct tagaggggag cagggcttca      1380
     ctggctctgc cctttcttct ccagtgcccc ccatggtgaa tgtcacccgc agcgaggcct      1440
     cagagggcaa cattaccgtg acatgcaggg cttctggctt ctatccctgg aatatcacac      1500
     tgagctggcg tcaggatggg gtatctttga gccacgacac ccagcagtgg ggggatgtcc      1560
     tgcctgatgg gaatggaacc taccagacct gggtggccac caggatttgc caaggagagg      1620
     agcagaggtt cacctgctac atggaacaca gcgggaatca cagcactcac cctgtgccct      1680
     ctggtgagcc tagggtgacc ctggagaggg tcaggccagg gtagggacag cagggatggc      1740
     tgtggctctc tgcccagtgt ataacaagtc cctttttttt cagggaaagt gctggtgctt      1800
     cagagtcatt ggcagacatt ccatgtttct gctgttgctg ctgctgctat ttttgttatt      1860
     attattttct atgtccgttg ttgtaagaag aaaacatcag ctgcagaggg tccag           1915
//


spacer
spacer