spacer

EBI Dbfetch

ID   AJ249938; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ249938;
XX
DT   01-OCT-1999 (Rel. 61, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*51011
DE   variant allele, exon 3
XX
KW   B5 antigen; HLA-B gene; HLA-B*51011 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Dunn P.P.;
RT   ;
RL   Submitted (30-SEP-1999) to the INSDC.
RL   Dunn P.P., Immunogenetics, Uktssa, Fox Den Road, Stoke Gifford, Bristol,
RL   BS34 8RR, UNITED KINGDOM.
XX
RN   [2]
RA   Bowerman C.J., Dunn P.P., Younie M.;
RT   "Nucleotide sequence of a HLA-B*51 variant allele";
RL   Unpublished.
XX
DR   MD5; 18add31f0beb61e11461fa985008742f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /standard_name="MHC class I antigen"
FT                   /product="human leucocyte antigen B"
FT                   /note="HLA-B*51011 allele"
FT                   /db_xref="GOA:Q9UIM6"
FT                   /db_xref="IMGT/HLA:B*51:01:04"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9UIM6"
FT                   /protein_id="CAB57303.1"
FT                   /translation="SHTWQTMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAA
FT                   DTAAQITQRKWEAAREAEQLRAYLEGLCVEWLRRHLENGKETLQRA"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="HLA-B*51011 allele"
XX
SQ   Sequence 276 BP; 54 A; 84 C; 103 G; 35 T; 0 other;
     ggtctcacac ttggcagacg atgtatggct gcgacgtggg gccggacggg cgcctcctcc        60
     gcgggcataa ccagtacgcc tacgacggca aggattacat cgccctgaac gaggacctga       120
     gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgaggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtgg ctccgcagac       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//


spacer
spacer