Dbfetch

ID   AJ249937; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ249937;
XX
DT   01-OCT-1999 (Rel. 61, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*51011
DE   variant allele, exon 2
XX
KW   B5 antigen; HLA-B gene; HLA-B*51011 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Dunn P.P.;
RT   ;
RL   Submitted (30-SEP-1999) to the INSDC.
RL   Dunn P.P., Immunogenetics, Uktssa, Fox Den Road, Stoke Gifford, Bristol,
RL   BS34 8RR, UNITED KINGDOM.
XX
RN   [2]
RA   Bowerman C.J., Dunn P.P., Younie M.;
RT   "Nucleotide sequence of a HLA-B*51 variant allele";
RL   Unpublished.
XX
DR   MD5; 36f4d0dfd129d13cf958dd848a3ffe80.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /standard_name="MHC class I antigen"
FT                   /product="human leucocyte antigen B"
FT                   /note="HLA-B*51011 allele"
FT                   /db_xref="IMGT/HLA:B*51:01:04"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q9UBX9"
FT                   /protein_id="CAB57302.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYNQSEA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="HLA-B*51011 allele"
XX
SQ   Sequence 270 BP; 60 A; 88 C; 84 G; 38 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcattgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg                                        270
//