spacer

EBI Dbfetch

ID   AJ249370; SV 1; linear; genomic DNA; STD; HUM; 788 BP.
XX
AC   AJ249370;
XX
DT   11-OCT-1999 (Rel. 61, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens HLA-A gene for MHC class 1 antigen, A*74 allele, exon 2
XX
KW   HLA-A gene; HLA-A*74 allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by Cox P. 16-SEP-1999
RP   1-788
RA   Little A.M.;
RT   ;
RL   Submitted (10-SEP-1999) to the INSDC.
RL   Little A.M., Hla, Anthony Nolan Research, The RFH, Pond Street, Hampstead,
RL   London, UNITED KINGDOM.
XX
RN   [3]
RX   DOI; 10.1034/j.1399-0039.2001.057001070.x.
RX   PUBMED; 11169261.
RA   Cox S.T., Mcwhinnie A.J., Koester R.P., Heine U., Holman R., Madrigal A.J.,
RA   Little A.M.;
RT   "Further diversity at HLA-A and -B loci identified in Afro-Caribbean
RT   potential bone marrow donors";
RL   Tissue Antigens 57(1):70-72(2001).
XX
DR   MD5; 4acf692ea5ecf686c7682b0228b6d940.
DR   Ensembl-Gn; ENSG00000223980; homo_sapiens.
DR   Ensembl-Tr; ENST00000454091; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..788
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..271,513..>788)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /product="human leucocyte antigen A"
FT                   /function="antigen presentation"
FT                   /note="A*74 allele"
FT                   /db_xref="GOA:P30459"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*74:04"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30459"
FT                   /protein_id="CAB58124.1"
FT                   /translation="GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRM
FT                   EPRAPWIEQEGPEYWDGETRKVKAHSQTDRVDLGTLRGYYNQSEAGSHTIQMMYGCDVG
FT                   PDGRLLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLEGT
FT                   CVEWLRRYLENGKETLQRT"
FT   exon            1..271
FT                   /gene="HLA-A"
FT                   /number=2
FT   intron          272..512
FT                   /gene="HLA-A"
FT                   /number=2
FT   exon            513..788
FT                   /gene="HLA-A"
FT                   /number=2
XX
SQ   Sequence 788 BP; 141 A; 247 C; 287 G; 113 T; 0 other;
     ggctcccact ccatgaggta tttcttcaca tccgtgtccc ggcccggccg cggggagccc        60
     cgcttcatcg ccgtgggcta cgtggacgac acgcagttcg tgcggtttga cagcgacgcc       120
     gcgagccaga ggatggagcc gcgggcgccg tggatagagc aggagggtcc ggagtattgg       180
     gacggggaga cacggaaagt gaaggcccac tcacagactg accgagtgga cctggggacc       240
     ctgcgcggct actacaacca gagcgaggcc ggtgagtgac cccggccggg ggcgcaggtc       300
     aggacccctc atcccccacg gacgggccag gtcgcccaca gtctccgggt ccgagatcca       360
     ccccgaagcc gcgggacccc gagacccttg ccccgggaga ggcccaggcg cctttacccg       420
     gtttcatttt cagtttaggc caaaaatccc cccgggttgg tcggggccgg acggggctcg       480
     ggggactggg ctgaccgtgg ggtcggggcc aggttctcac accatccaga tgatgtatgg       540
     ctgcgacgtg gggccggacg ggcgcctcct ccgcgggtac cagcaggacg cctacgacgg       600
     caaggattac atcgccttga acgaggacct gcgctcttgg accgcggcgg acatggcggc       660
     tcagatcacc cagcgcaagt gggaggcggc ccgtgtggcg gagcagttga gagcctacct       720
     ggagggcacg tgcgtggagt ggctccgcag atacctggag aacgggaagg agacgctgca       780
     gcgcacgg                                                                788
//


spacer
spacer