spacer

EBI Dbfetch

ID   AJ245881; SV 1; linear; mRNA; STD; HUM; 857 BP.
XX
AC   AJ245881;
XX
DT   15-FEB-2000 (Rel. 62, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens partial mRNA for MHC class II antigen (HLA-DRB1*0402 allele)
XX
KW   HLA-DRB1 gene; HLA-DRB1*0402 allele; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-857
RA   Snijders A.;
RT   ;
RL   Submitted (13-AUG-1999) to the INSDC.
RL   Snijders A., Immunohematology and Blood Bank, Leiden University Medical
RL   Center, E3-Q, PO Box 9600, 2300 RC Leiden, NETHERLANDS.
XX
RN   [2]
RX   PUBMED; 11290778.
RA   Snijders A., Elferink D.G., Geluk A., van der Zanden A.L., Vos K.,
RA   Schreuder G.M.T., Breeveld F.C., de Vries R.R.P., Zanelli E.H.;
RT   "An HLA-DRB1-derived peptide associated with protection against rheumatoid
RT   arthritis is naturally processed by human APCs";
RL   J. Immunol. 166(8):4987-4993(2001).
XX
DR   MD5; ed593bfe5e66a8777b0feb3898949dea.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..857
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /cell_line="YAR"
FT                   /cell_type="B lymphocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..795
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /standard_name="MHC class II antigen"
FT                   /product="human leucocyte antigen DRB1"
FT                   /note="DRB1*0402 allele"
FT                   /db_xref="GOA:Q9MYB9"
FT                   /db_xref="H-InvDB:HIT000245902.12"
FT                   /db_xref="IMGT/HLA:DRB1*04:02:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MYB9"
FT                   /protein_id="CAB75359.1"
FT                   /translation="CLKFPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEQVKHECHFF
FT                   NGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDERAAVDT
FT                   YCRHNYGVVESFTVQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQ
FT                   EEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRARSESA
FT                   QSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS"
FT   sig_peptide     <1..81
FT                   /gene="HLA-DRB1"
FT                   /note="DRB1*0402 allele"
FT   mat_peptide     82..792
FT                   /gene="HLA-DRB1"
FT                   /standard_name="MHC class II antigen"
FT                   /product="human leucocyte antigen DRB1"
FT                   /note="DRB1*0402 allele"
XX
SQ   Sequence 857 BP; 193 A; 221 C; 268 G; 175 T; 0 other;
     tgtctgaagt tccctggagg ctcctgcatg gcagctctga cagtgacact gatggtgctg        60
     agctccccac tggctttggc tggggacacc cgaccacgtt tcttggagca ggttaaacat       120
     gagtgtcatt tcttcaacgg gacggagcgg gtgcggttcc tggacagata cttctatcac       180
     caagaggagt acgtgcgctt cgacagcgac gtgggggagt accgggcggt gacggagctg       240
     gggcggcctg atgccgagta ctggaacagc cagaaggaca tcctggaaga cgagcgggcc       300
     gcggtggaca cctactgcag acacaactac ggggttgtgg agagcttcac agtgcagcgg       360
     cgagtctatc ctgaggtgac tgtgtatcct gcaaagaccc agcccctgca gcaccacaac       420
     ctcctggtct gctctgtgaa tggtttctat ccaggcagca ttgaagtcag gtggttccgg       480
     aacggccagg aagagaagac tggggtggtg tccacaggcc tgatccagaa tggagactgg       540
     accttccaga ccctggtgat gctggaaaca gttcctcgga gtggagaggt ttacacctgc       600
     caagtggagc acccaagcct gacgagccct ctcacagtgg aatggagagc acggtctgaa       660
     tctgcacaga gcaagatgct gagtggagtc gggggcttcg tgctgggcct gctcttcctt       720
     ggggccgggc tgttcatcta cttcaggaat cagaaaggac actctggact tcagccaaca       780
     ggattcctga gctgaagtga agatgaccac attcaaggaa gaaccttctg ccccagcttt       840
     gcaggatgaa acacttc                                                      857
//


spacer
spacer