Dbfetch

ID   AJ243898; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ243898;
XX
DT   23-JUL-1999 (Rel. 60, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-DRB1 gene for MHC class II antigen, B1*1311 allele, exon 2
XX
KW   HLA-B1*1311 allele; HLA-DRB1; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Guttridge M.G.;
RT   ;
RL   Submitted (22-JUL-1999) to the INSDC.
RL   Guttridge M.G., Tissue Typing, Welsh Blood Service, Ely Valley Road, Talbot
RL   Green, Pontyclun, Cardiff, CF72 9WB, UNITED KINGDOM.
XX
RN   [2]
RA   Guttridge M.G.;
RT   "Confirmatory sequence of HLA-DRB1*1311";
RL   Unpublished.
XX
DR   MD5; 05fa72a845585381645c66bde9b42d66.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="1083933+"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /standard_name="MHC class II antigen"
FT                   /product="human leucocyte antigen B"
FT                   /function="antigen presenting molecule"
FT                   /note="B1*1311 allele"
FT                   /db_xref="GOA:Q9UM38"
FT                   /db_xref="IMGT/HLA:DRB1*13:11:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9UM38"
FT                   /protein_id="CAB51475.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT                   /note="B1*1311 allele"
XX
SQ   Sequence 270 BP; 57 A; 64 C; 96 G; 53 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//