Dbfetch

ID   AJ243738; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ243738;
XX
DT   14-JUL-1999 (Rel. 60, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, B*35KM gene, exon 3
XX
KW   B*35KM allele; HLA-B gene; human leucocyte antigen B;
KW   major histocompatibilty complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Blasczyk R.;
RT   ;
RL   Submitted (12-JUL-1999) to the INSDC.
RL   Blasczyk R., Department of Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [2]
RA   Elsner H.A., Blasczyk R.;
RT   "A new HLA-B*35 variant.";
RL   Unpublished.
XX
DR   MD5; e38af4c1461da0cc522a660fa8c4297a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="MHH994949"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="EBV transformed lymphoblastoid cell line"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B*35KM"
FT                   /standard_name="MHC class I antigen"
FT                   /product="human leucocyte antigen B"
FT                   /function="alpha2-domain"
FT                   /db_xref="IMGT/HLA:B*35:37"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q9UM39"
FT                   /protein_id="CAB50865.1"
FT                   /translation="SHTWQTMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAA
FT                   DTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRA"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="HLA-B*35KM"
XX
SQ   Sequence 276 BP; 51 A; 86 C; 102 G; 37 T; 0 other;
     ggtctcacac ttggcagacg atgtatggct gcgacctggg gcccgacggg cgcctcctcc        60
     gcgggcatga ccagtccgcc tacgacggca aggattacat cgccctgaac gaggacctga       120
     gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgtggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//