spacer

EBI Dbfetch

ID   AJ242833; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ242833;
XX
DT   06-JAN-2001 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-DRB4 gene, exon 2, isolate MG, partial
XX
KW   HLA-DRB4 gene; human leukocyte antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   van den Berg-Loonen E.M.;
RT   ;
RL   Submitted (03-JUN-1999) to the INSDC.
RL   van den Berg-Loonen E.M., Tissue Typing Laboratory, University Hospital
RL   Maastricht, P.O. Box 5800, 6202 AZ Maastricht, NETHERLANDS.
XX
RN   [2]
RA   Voorter C.E., van den Berg-Loonen E.M.;
RT   "New DRB4 allele identified by sequence-based typing";
RL   Unpublished.
XX
DR   MD5; 664f64f5f7a352aa2d78b2fac794588f.
DR   Ensembl-Gn; ENSG00000227357; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231021; homo_sapiens.
DR   Ensembl-Tr; ENST00000411565; homo_sapiens.
DR   Ensembl-Tr; ENST00000411959; homo_sapiens.
DR   Ensembl-Tr; ENST00000457451; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="MG"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB4"
FT                   /product="human leukocyte antigen"
FT                   /db_xref="GOA:Q9GIJ6"
FT                   /db_xref="IMGT/HLA:DRB4*01:03:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9GIJ6"
FT                   /protein_id="CAC20415.1"
FT                   /translation="RFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAV
FT                   TELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRR"
FT   exon            <1..>270
FT                   /gene="HLA-DRB4"
FT                   /number=2
XX
SQ   Sequence 270 BP; 65 A; 61 C; 96 G; 48 T; 0 other;
     cacgtttctt ggagcaggct aagtgtgagt gtcatttcct caatgggacg gagcgagtgt        60
     ggaacctgat cagatacatc tataaccaag aggagtacgc gcgctacaac agtgacctgg       120
     gggagtacca ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacctcct ggagcggagg cgggccgagg tggacaccta ttgcagatac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer