Dbfetch

ID   AJ238694; SV 2; linear; genomic DNA; STD; HUM; 3091 BP.
XX
AC   AJ238694;
XX
DT   03-MAY-1999 (Rel. 59, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-C gene, allele Cw*04011, exons 1-7
XX
KW   HLA-C gene; human leucocyte antigen C; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Revised by [3]
RA   Dunn P.P.;
RT   ;
RL   Submitted (29-APR-1999) to the INSDC.
RL   Dunn P.P., Immunogenetics, Uktssa, Fox Den Road, Stoke Gifford, Bristol,
RL   BS34 8RR, UNITED KINGDOM.
XX
RN   [2]
RA   Dunn P.P., van Dam M., Crosby I., Carter V.;
RT   "A sequencing strategy for the rapid sequencing of HLA Class I genes using
RT   random in vitro DNA transposition";
RL   Unpublished.
XX
RN   [3]
RP   1-3091
RA   Dunn P.P.;
RT   ;
RL   Submitted (27-JUL-1999) to the INSDC.
RL   Dunn P.P., Immunogenetics, Uktssa, Fox Den Road, Stoke Gifford, Bristol,
RL   BS34 8RR, UNITED KINGDOM.
XX
DR   MD5; 0c50b5c04cb3d88a72a04cf6e37ca41c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3091
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="BeWo"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(1..73,204..473,720..995,1583..1858,1980..2099,
FT                   2539..2571,2679..2726)
FT                   /gene="HLA-C"
FT                   /note="allele Cw*04011"
FT   CDS             join(1..73,204..473,720..995,1583..1858,1980..2099,
FT                   2539..2571,2679..>2726)
FT                   /gene="HLA-C"
FT                   /product="human leucocyte antigen C"
FT                   /function="cell surface antigen"
FT                   /note="allele Cw*04011"
FT                   /db_xref="GOA:P30504"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*04:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="PDB:1IM9"
FT                   /db_xref="PDB:1QQD"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30504"
FT                   /protein_id="CAB41889.2"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFSTSVSWPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPREPWVEQEGPEYWDRETQKYKRQAQADRVNLRK
FT                   LRGYYNQSEDGSHTLQRMFGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWKPSSQPTIPIVGIVAGLAVLAVLAVLGAMVAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACK"
FT   sig_peptide     1..73
FT                   /gene="HLA-C"
FT                   /note="allele Cw*04011"
FT   exon            1..73
FT                   /gene="HLA-C"
FT                   /number=1
FT                   /note="allele Cw*04011"
FT   intron          74..203
FT                   /gene="HLA-C"
FT                   /number=1
FT                   /note="allele Cw*04011"
FT   mat_peptide     join(204..473,720..995,1583..1858,1980..2099,2539..2571,
FT                   2679..2726)
FT                   /gene="HLA-C"
FT                   /product="human leucocyte antigen Cw"
FT                   /note="allele Cw*04011"
FT   exon            204..473
FT                   /gene="HLA-C"
FT                   /number=2
FT                   /note="allele Cw*04011"
FT   intron          474..719
FT                   /gene="HLA-C"
FT                   /number=2
FT                   /note="allele Cw*04011"
FT   exon            720..995
FT                   /gene="HLA-C"
FT                   /number=3
FT                   /note="allele Cw*04011"
FT   intron          996..1582
FT                   /gene="HLA-C"
FT                   /number=3
FT                   /note="allele Cw*04011"
FT   exon            1583..1858
FT                   /gene="HLA-C"
FT                   /number=4
FT                   /note="allele Cw*04011"
FT   intron          1859..1979
FT                   /gene="HLA-C"
FT                   /number=4
FT                   /note="allele Cw*04011"
FT   exon            1980..2099
FT                   /gene="HLA-C"
FT                   /number=5
FT                   /note="allele Cw*04011"
FT   intron          2100..2538
FT                   /gene="HLA-C"
FT                   /number=5
FT                   /note="allele Cw*04011"
FT   exon            2539..2571
FT                   /gene="HLA-C"
FT                   /number=6
FT                   /note="allele Cw*04011"
FT   intron          2572..2678
FT                   /gene="HLA-C"
FT                   /number=6
FT                   /note="allele Cw*04011"
FT   exon            2679..2726
FT                   /gene="HLA-C"
FT                   /number=7
FT                   /note="allele Cw*04011"
XX
SQ   Sequence 3091 BP; 585 A; 884 C; 974 G; 648 T; 0 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccggtgagtg cggggttggg agggaaacgg cctctgggga gaggagcgag       120
     gggcccgccc ggcgagggcg caggacccgg gaagccgcgc agggaggagg gtcgggcggg       180
     tctcagccac tcctcgtccc caggctccca ctccatgagg tatttctcca catccgtgtc       240
     ctggcccggc cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagtcc aagaggggag ccgcgggagc cgtgggtgga       360
     gcaggagggg ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacaggc       420
     tgaccgagtg aacctgcgga aactgcgcgg ctactacaac cagagcgagg acggtgagtg       480
     accccggccc ggggcgcagg tcacgacccc tccccatccc ccacggacgg cccgggtcgc       540
     cccgagtctc cccgtctgag atccaccccg aggctgcgga acccgcccag accctcgacc       600
     ggagagagcc ccagtcacct ttacccggtt tcattttcag tttaggccaa aatccccgcg       660
     ggttggtcgg gactggggcg gggctcgggg gaccgggctg accacggggg cggggccagg       720
     gtctcacacc ctccagagga tgtttggctg cgacctgggg ccggacgggc gcctcctccg       780
     cgggtataac cagttcgcct acgacggcaa ggattacatc gccctgaacg aggatctgcg       840
     ctcctggacc gccgcggaca cggcggctca gatcacccag cgcaagtggg aggcggcccg       900
     tgaggcggag cagcggagag cctacctgga gggcacgtgc gtggagtggc tccgcagata       960
     cctggagaac gggaaggaga cgctgcagcg cgcgggtacc aggggcagtg gggagccttc      1020
     cccatctccc gtagatctcc cgggatggcc tcccacgagg aggggaggaa aatgggatca      1080
     gcgctagaat atcgccctcc cttgaatgga gaatgggatg agttttcctg agtttcctct      1140
     gagggccccc tctgctctct aggacaatta agggatgaag tccttgagga aatggagggg      1200
     aagacagtcc ctggaatact gatcaggggt cccctttgac cactttgacc actgcagcag      1260
     ctgtggtcag gctgctgacc tttctctcag gccttgttct ctgcctgacg ctcaatgtgt      1320
     ttgaaggttt gattccagct tttctgagtc cttcggcctc cactcaggtc aggaccagaa      1380
     gtcgctgttc ctccctcaga gactagaact ttccaatgaa taggagatta tcccaggtgc      1440
     ctgtgtccag gctggcgtct gggttctgtg cccccttccc caccccaggt gtcctgtcca      1500
     ttctcaggat ggtcacatgg gcgctgttgg agtgtcgcaa gagagataca aagtgtctga      1560
     attttctgac tcttcccatc agaacaccca aagacacacg tgacccacca tcccgtctct      1620
     gaccatgagg ccaccctgag gtgctgggcc ctgggcttct accctgcgga gatcacactg      1680
     acctggcagt gggatgggga ggaccaaact caggacaccg agcttgtgga gaccaggcca      1740
     gcaggagatg gaaccttcca gaagtgggca gctgtggtgg tgccttctgg agaagagcag      1800
     agatacacgt gccatgttca gcacgagggg ctgccggagc ccctcaccct gagatggagt      1860
     aaggaggggg atgaggggtg atgtgtcttc tcagggaaag cagaagtcct ggagcccttc      1920
     agccgggtca gggctgaggc ttgaaggtca gggcccctca ccttcccctc ctttcccaga      1980
     gccgtcttcc cagcccacca tccccatcgt gggcatcgtt gctggcctgg ctgtcctggc      2040
     tgtcctagct gtcctaggag ctatggtggc tgttgtgatg tgtaggagga agagctcagg      2100
     tagggaaggg gtgaggagtg gggtctgggt tttcttgttc cactgggagt ttcaagcccc      2160
     aggtagaagt gtgccccacc tcgttactgg aagcaccatc cacacatggg ccatcccagc      2220
     ctgggaccct gtgtgccagc acttactctg ttgtgaagca catgacaatg aaggacagat      2280
     gtatcacctt gatgattatg gtgttggggt ccttgattcc agcattcatg agtcagggga      2340
     aggtccctgc taaggacaga ccttaggagg gcagttgctt cagaacccac agctgctttc      2400
     cccgtgtttc ctgatcctgc cctgggtctg cagtcatagt tctggaaact tctcttgggt      2460
     ccaagactag gaggttcccc taagatcgca tggccctgcc tcctccctgt cccctcacag      2520
     ggcattttct tcccacaggt ggaaaaggag ggagctgctc tcaggctgcg tgtaagtgat      2580
     ggcggtgggc gtgtggagga gctcacccac cccataattc ctcttgtccc acatctcctg      2640
     cgggctctga ccaggtcttt ttttttgttc taccccagcc agcaacagtg cccagggctc      2700
     tgatgagtct ctcatcgctt gtaaaggtga gattctgggg agctgaagtg gtcgggggtg      2760
     gggcagaggg aaaaggccta ggtaatgggg atcctttgat tgggacgttt cgaatgtgtg      2820
     gtgagctgtt cagagtgtca tcacttacca tgactgacct gaatttgttc atgactattg      2880
     tgttctgtag cctgagacag ctgcctgtgt gggactgaga tgcaggattt cttcacacct      2940
     ctcctttgtg acttcaagag cctctggcat ctctttctgc aaaggcatct gaatgtgtct      3000
     gcgttcctgt tagcataatg tgaggaggtg gagagacagc ccacccccgt gtccaccgtg      3060
     acccctgtcc ccacactgac ctgtgttctc t                                     3091
//