Dbfetch

ID   AJ238362; SV 1; linear; genomic DNA; STD; HUM; 52 BP.
XX
AC   AJ238362;
XX
DT   27-APR-1999 (Rel. 59, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MHC class I HLA-A gene, A*68 allele, exon 1, and joined CDS
XX
KW   alpha chain; HLA-A gene; HLA-A*68 allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-52
RA   Fischer G.F.;
RT   ;
RL   Submitted (22-APR-1999) to the INSDC.
RL   Fischer G.F., Department of Blood Group Serology, University of Vienna,
RL   Waehringer Guertel 18-20, A-1090 Vienna, AUSTRIA.
XX
RN   [2]
RX   DOI; 10.1034/j.1399-0039.2000.560311.x.
RX   PUBMED; 11034565.
RA   Fae I., Gleissner B., Kriks D., Leitner D., Fischer G.F.;
RT   "Serological and nucleotide sequence analysis of HLA-A*6812";
RL   Tissue Antigens 56(3):276-278(2000).
XX
DR   MD5; b5beab1f2d20631aa6e97a620c8ceca2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..52
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="Austria:Upper Austria"
FT                   /haplotype="A1, 68; B18, 57; Cw2, w6; DR11, 15;"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..52,AJ238363.1:1..270,AJ238364.1:1..>276)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /standard_name="MHC class I antigen"
FT                   /product="human leucocyte antigen A alpha chain"
FT                   /function="antigen presenting molecule"
FT                   /note="A*68 allele"
FT                   /db_xref="IMGT/HLA:A*68:12"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q9UQU0"
FT                   /protein_id="CAB41636.1"
FT                   /translation="TLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPRFIAVGYV
FT                   DDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGTLRGYYNQ
FT                   SEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALKEDLRSWTAADMAAQITKHK
FT                   WEAAHVAEQWRAYLEGTCVEWLRRYLENGKETLQRT"
FT   exon            <1..52
FT                   /gene="HLA-A"
FT                   /number=1
FT                   /note="A*68 allele"
XX
SQ   Sequence 52 BP; 5 A; 22 C; 16 G; 9 T; 0 other;
     accctcgtcc tgctactctc gggggccctg gccctgaccc agacctgggc gg                52
//