Dbfetch

ID   AJ237899; SV 1; linear; genomic DNA; STD; HUM; 258 BP.
XX
AC   AJ237899;
XX
DT   16-JUL-1999 (Rel. 60, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II HLA-DRB1 gene, HLA-DRB1*0301 allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*0301 allele; human leucocyte antigen D;
KW   major histocompatibilty complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-258
RA   Mueller C.A.;
RT   ;
RL   Submitted (16-APR-1999) to the INSDC.
RL   Mueller C.A., Dept. II, Med. Univ. Clinics, Sect. Transplantation.Immunol.
RL   and Immunohematol., Otfried-mueller-Str. 10, 72076 Tuebingen, 72076 ,
RL   GERMANY.
XX
RN   [2]
RA   Mueller C.A., Roesner L., Steiert I., Bauer C.;
RT   "A new HLA-DRB1*03 allele";
RL   Unpublished.
XX
DR   MD5; 93a11c4e7f1d841847e6645a0fb90203.
XX
CC   exon 2
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..258
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="peripheral blood lymphocytes"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>258
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="human leucocyte antigen D"
FT                   /function="antigen presenting molecule"
FT                   /note="DRB1*0301A allele"
FT                   /db_xref="GOA:Q9Y4H8"
FT                   /db_xref="IMGT/HLA:DRB1*03:15"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Y4H8"
FT                   /protein_id="CAB51036.1"
FT                   /translation="EYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVTEL
FT                   GRPDAEYWNSQKDLLEQKRGRVDTYCRHNYGVVESFTVQR"
FT   exon            1..258
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT                   /note="DRB1*0301A allele"
XX
SQ   Sequence 258 BP; 57 A; 61 C; 95 G; 45 T; 0 other;
     tggagtactc tacgtctgag tgtcatttct tcaatgggac ggagcgggtg cggtacctgg        60
     acagatactt ccataaccag gaggagaacg tgcgcttcga cagcgacgtg ggggagttcc       120
     gggcggtgac ggagctgggg cggcctgatg ccgagtactg gaacagccag aaggacctcc       180
     tggagcagaa gcggggccgg gtggacacct actgcagaca caactacggg gttgtggaga       240
     gcttcacagt gcagcgga                                                     258
//