spacer

EBI Dbfetch

ID   AJ233953; SV 1; linear; genomic DNA; STD; ROD; 1141 BP.
XX
AC   AJ233953;
XX
DT   02-MAR-1999 (Rel. 59, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Acomys cahirinus mitochondrial cytb gene, specimen voucher 00300,
DE   collection of MJR Jordan at Sparsholt College, Hampshire
XX
KW   cytb gene; cytochrome b.
XX
OS   Acomys cahirinus (Egyptian spiny mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Deomyinae; Acomys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1141
RA   Barome P.O.;
RT   ;
RL   Submitted (10-OCT-1998) to the INSDC.
RL   Barome P.O., CNRS, Centre de Genetique Moleculaire, allee de la terrasse,
RL   91198 Gif-sur-Yvette, FRANCE.
XX
RN   [2]
RX   DOI; 10.1006/mpev.2000.0859.
RX   PUBMED; 11161740.
RA   Barome P.O., Lymberakis P., Monnerot M., Gautun J.C.;
RT   "Cytochrome b sequences reveal Acomys minous (Rodentia, Muridae) paraphyly
RT   and answer the question about the ancestral karyotype of Acomys
RT   dimidiatus";
RL   Mol. Phylogenet. Evol. 18(1):37-46(2001).
XX
DR   MD5; 54438fbb64f592386ef45361d9cc5e01.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1141
FT                   /organism="Acomys cahirinus"
FT                   /organelle="mitochondrion"
FT                   /isolate="Cairo"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="00300, collection of MJR Jordan at
FT                   Sparsholt College, Hampshire"
FT                   /db_xref="taxon:10068"
FT   CDS             1..>1141
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /note="incomplete stop codon; gene terminated by
FT                   post-transcriptional polyadenylation"
FT                   /db_xref="GOA:Q9TGN5"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TGN5"
FT                   /protein_id="CAB37993.1"
FT                   /translation="MKIMRKTHPLLKIINHAFVDLPAPSNISSWWNFGSLLGVCLVIQI
FT                   LTGLFLAMHYTSDTMTAFSSVTHICRDVNYGWLIRYLHANGASMFFVCLFMHVGRGIYY
FT                   GSYTFTETWNLGIILLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVEW
FT                   IWGGFSVDKATLTRFFALHFILPFIIAALAMVHLLFLHETGSNNPTGVNSDADKIPFHP
FT                   YYTIKDLLGVFLMLLVLLLLVLFSPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALVMSILILIFMPLTHTSKQRSLMFRPISQAMFWILTANLLILTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILILMPISGLIENKMLKLN"
XX
SQ   Sequence 1141 BP; 344 A; 344 C; 148 G; 305 T; 0 other;
     atgaaaatta tacgaaaaac acacccactc ctaaaaatca ttaatcacgc attcgtcgac        60
     ctccctgcac cctctaacat ctcatcatga tgaaacttcg gctccctatt aggagtatgc       120
     ctagtaatcc aaatcctcac aggactattt ctagcaatac actacacctc cgacactata       180
     acagcattct catccgtaac ccacatctgc cgagacgtaa actacggctg attaattcga       240
     tacctccatg caaatggggc ttccatattc ttcgtgtgct tattcataca cgtaggacga       300
     ggcatttact atggatctta caccttcaca gagacatgaa accttggtat cattctactg       360
     tttgccgtaa tagcaactgc atttatagga tatgtccttc catggggaca aatatccttc       420
     tgaggggcca cagtcattac aaacctactc tcagctatcc cctacatcgg cactgacctg       480
     gtagagtgaa tctgaggcgg gttttcagta gacaaagcca cccttacacg cttcttcgca       540
     ttacacttta ttctcccctt tattattgca gccctagcca tagtacacct actctttcta       600
     cacgaaacag gctctaataa ccccacagga gtaaactccg atgcagacaa aatccccttc       660
     cacccctact acacaatcaa agacctttta ggtgtattcc tcatactatt agtcctcctc       720
     ctactagtac tattctcccc agacctacta ggagaccccg acaactacac accagctaac       780
     cccctgaaca cccctcctca cattaaacca gaatgatact tcctattcgc atatgctatt       840
     ctacgctcca tccccaacaa actcggaggt gtactagctc tagtaatatc tatcctaatc       900
     ctaattttca tacccctcac ccacacctca aaacaacgaa gcttaatatt ccgcccaatc       960
     agtcaggcta tattctgaat cctaacagct aacctactca tcctaacctg aatcggagga      1020
     caacccgtag aacacccctt tatcattatc ggccaactag cttcaatcag ctacttctcc      1080
     attattttaa tcctaatacc aatctcagga ctaattgaaa acaaaatact aaaattaaac      1140
     t                                                                      1141
//


spacer
spacer