spacer

EBI Dbfetch

ID   AJ223602; SV 1; linear; mRNA; STD; HUM; 546 BP.
XX
AC   AJ223602;
XX
DT   26-JAN-1998 (Rel. 54, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Homo sapiens HLA-B*07 variant (B*07AE), exons 2 and 3, isolate 980043
XX
KW   HLA-B gene; HLA-B*07AE allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RA   Blasczyk R.;
RT   ;
RL   Submitted (25-JAN-1998) to the INSDC.
RL   Blasczyk R., Department of Hematology and Oncology, Blood Bank, Charite,
RL   Campus Virchow, Humboldt-University, Augustenburger Platz 1, Berlin, 13353,
RL   GERMANY.
XX
RN   [2]
RX   DOI; 10.1034/j.1399-0039.2000.560410.x.
RX   PUBMED; 11098938.
RA   Elsner H.A., Blasczyk R.;
RT   "Increased diversity within the HLA-B*07 group: identification of the two
RT   novel alleles B*0709 and B*0710";
RL   Tissue Antigens 56(4):371-375(2000).
XX
DR   MD5; e5dd16120673e3a8429f57bbb83c7914.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="980043"
FT                   /mol_type="mRNA"
FT                   /cell_type="lymphocytes"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /standard_name="MHC class 1 antigen"
FT                   /product="Human leucocyte antigen B"
FT                   /function="antigen presenting molecule"
FT                   /note="B*07AE allele"
FT                   /db_xref="GOA:O78043"
FT                   /db_xref="IMGT/HLA:B*07:10"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O78043"
FT                   /protein_id="CAA11468.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQICKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGEC
FT                   VEWLRRYLENGKDKLERA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*07AE allele"
FT   exon            271..546
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B*07AE allele"
XX
SQ   Sequence 546 BP; 110 A; 172 C; 195 G; 69 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctgc aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacac cctccagagc atgtacggct       300
     gcgacgtggg gccggacggg cgcctcctcc gcgggcatga ccagtacgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctgc gctcctggac cgccgcggac acggcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgaggcgga gcagcggaga gcctacctgg       480
     agggcgagtg cgtggagtgg ctccgcagat acctggagaa cgggaaggac aagctggagc       540
     gcgctg                                                                  546
//


spacer
spacer