spacer

EBI Dbfetch

ID   AJ223282; SV 1; linear; genomic DNA; STD; HUM; 546 BP.
XX
AC   AJ223282;
XX
DT   25-OCT-1998 (Rel. 57, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo Sapiens HLA-B gene, exons 2 & 3
XX
KW   HLA-B gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RA   De Canck I.;
RT   ;
RL   Submitted (12-JAN-1998) to the INSDC.
RL   De Canck I., Nucleic Acid Chemistry, Innogenetics, Industriepark Zwijnaarde
RL   7 box 4, B-9052 Gent, BELGIUM.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.1998.tb03091.x.
RX   PUBMED; 9894859.
RA   Maertens R., De Canck I., Moraes M.E., Vande Casteele N., Van Reybroeck G.,
RA   Vanderborght B., Moraes J.R., Rossau R.;
RT   "Characterization of a new HLA-B39 allele, B*3913, in a Brazilian
RT   Caucasian";
RL   Tissue Antigens 52(6):583-586(1998).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="p"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <74..>546
FT                   /codon_start=2
FT                   /gene="HLA-B"
FT                   /db_xref="GOA:Q9TNT8"
FT                   /db_xref="IMGT/HLA:B*39:13:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TNT8"
FT                   /protein_id="CAA11220.1"
FT                   /translation="GYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQISKTN
FT                   TQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQFAYDGKDYIALNED
FT                   LSSWTAADTAAQITQRKWEAARVAEQLRTYLEGTCVEWLRRYLENGKETLQRA"
XX
SQ   Sequence 546 BP; 112 A; 171 C; 191 G; 72 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacac cctccagagg atgtacggct       300
     gcgacgtggg gccggacggg cgcctcctcc gcgggcataa ccagttcgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctga gctcctggac cgcggcggac accgcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcagctgaga acctacctgg       480
     agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcgcgg                                                                  546
//


spacer
spacer