spacer

EBI Dbfetch

ID   AJ223060; SV 1; linear; mRNA; STD; HUM; 619 BP.
XX
AC   AJ223060;
XX
DT   06-JAN-1998 (Rel. 54, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Homo sapiens HLA-A*7402 gene, exons 1-3
XX
KW   HLA-A*7402 gene; major histocompatability complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Revised by author 05-JAN-1998
RP   1-619
RA   Blasczyk R.;
RT   ;
RL   Submitted (12-DEC-1997) to the INSDC.
RL   Blasczyk R., Dep. of Internal Medicine, Charite, Humboldt-University,
RL   Bloodbank, Division of Hematology and Oncology, Augustenburger Platz 1,
RL   Berlin, 13353, GERMANY.
XX
RN   [2]
RA   Blasczyk R.;
RT   ;
RL   Unpublished.
XX
DR   MD5; 99a1153a4cbcf537a8dfd2ffc4ff522f.
DR   Ensembl-Gn; ENSG00000223980; homo_sapiens.
DR   Ensembl-Tr; ENST00000454091; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..619
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="BT2358"
FT                   /mol_type="mRNA"
FT                   /cell_type="lymphocytes"
FT                   /tissue_type="blood"
FT                   /note="A*4301,7402;B*15,-"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,74..343,344..>619)
FT                   /gene="HLA-A*7402"
FT                   /product="HLA-A74"
FT                   /db_xref="GOA:P30459"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*74:02:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30459"
FT                   /protein_id="CAA11063.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAHSQTDRVDLGT
FT                   LRGYYNQSEAGSHTIQMMYGCDVGPDGRLLRGYQQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRT"
FT   sig_peptide     1..73
FT                   /gene="HLA-A*7402"
FT   exon            1..73
FT                   /gene="HLA-A*7402"
FT                   /number=1
FT   mat_peptide     join(74..343,344..>619)
FT                   /gene="HLA-A*7402"
FT                   /product="HLA-A74"
FT   exon            74..343
FT                   /gene="HLA-A*7402"
FT                   /number=2
FT   exon            344..619
FT                   /gene="HLA-A*7402"
FT                   /number=3
XX
SQ   Sequence 619 BP; 114 A; 193 C; 220 G; 92 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct tgggggccct ggccctgacc        60
     cagacctggg cgggctccca ctccatgagg tatttcttca catccgtgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt cgtgcggttt       180
     gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggaccagga gacacggaat gtgaaggccc actcacagac tgaccgagtg       300
     gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggttctca caccatccag       360
     atgatgtatg gctgcgacgt ggggccggac gggcgcctcc tccgcgggta ccagcaggac       420
     gcctacgacg gcaaggatta catcgccttg aacgaggacc tgcgctcttg gaccgcggcg       480
     gacatggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagttg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcacgg                                                    619
//


spacer
spacer