spacer

EBI Dbfetch

ID   AJ133492; SV 1; linear; genomic DNA; STD; HUM; 243 BP.
XX
AC   AJ133492;
XX
DT   06-MAR-2000 (Rel. 63, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-DRB1 gene, DRB1*04 allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*04 allele; human leucocyte antigen DR;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-243
RA   Lebeer K.M.W.;
RT   ;
RL   Submitted (05-MAR-1999) to the INSDC.
RL   Lebeer K.M.W., Nucleic Acid Chemistry Department, Innogenetics,
RL   Industriepark Zwijnaarde 7, Box 4, 9052 Zwijnaarde, BELGIUM.
XX
RN   [2]
RA   Marsh S.G.E.;
RT   "Nomenclature for factors of the HLA system";
RL   Unpublished.
XX
DR   MD5; 4b44e569a40eae60279a28e6e37e9597.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..243
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="Czech Republic"
FT                   /cell_type="leucocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>243
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /standard_name="MHC class II antigen"
FT                   /product="human leucocyte antigen DRB1"
FT                   /function="antigen presenting molecule"
FT                   /note="DRB1*04 allele"
FT                   /db_xref="GOA:Q9MYC2"
FT                   /db_xref="IMGT/HLA:DRB1*04:34"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MYC2"
FT                   /protein_id="CAB76922.1"
FT                   /translation="FLEQVKPECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVT
FT                   ELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVG"
FT   exon            <1..>243
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT                   /note="B1*04 allele"
XX
SQ   Sequence 243 BP; 53 A; 58 C; 87 G; 45 T; 0 other;
     tttcttggag caggttaaac ctgagtgtca tttcttcaac gggacggagc gggtgcggtt        60
     cctggacaga tacttctatc accaagagga gtacgtgcgc ttcgacagcg acgtggggga       120
     gtaccgggcg gtgacggagc tggggcggcc tgatgccgag tactggaaca gccagaagga       180
     cctcctggag cagaagcggg ccgcggtgga cacctactgc agacacaact acggggttgg       240
     tga                                                                     243
//


spacer
spacer