spacer

EBI Dbfetch

ID   AJ133474; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ133474;
XX
DT   01-MAR-1999 (Rel. 59, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-C gene, Cw*0304 allele, exon 2
XX
KW   HLA-C gene; HLA-Cw*0304 allele; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Dunn P.P.;
RT   ;
RL   Submitted (25-FEB-1999) to the INSDC.
RL   Dunn P.P., Immunogenetics, Uktssa, Fox Den Road, Stoke Gifford, Bristol
RL   BS34 8RR, UNITED KINGDOM.
XX
RN   [2]
RA   Bird T., Dunn P.P., Bunce M.;
RT   "Three new HLA class I alleles in an individual from Kenya";
RL   Unpublished.
XX
DR   MD5; 530a0dbab2ef753a9a9439d28eec6c2f.
DR   Ensembl-Gn; ENSG00000225691; homo_sapiens.
DR   Ensembl-Tr; ENST00000419135; homo_sapiens.
DR   Ensembl-Tr; ENST00000429840; homo_sapiens.
DR   Ensembl-Tr; ENST00000433153; homo_sapiens.
DR   Ensembl-Tr; ENST00000445075; homo_sapiens.
DR   Ensembl-Tr; ENST00000457903; homo_sapiens.
DR   Ensembl-Tr; ENST00000491984; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Kenya"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /number=2
FT                   /note="Cw*0304 allele"
FT   CDS             <3..>270
FT                   /gene="HLA-C"
FT                   /standard_name="MHC class I antigen"
FT                   /product="human leucocyte antigen C"
FT                   /function="presents peptides to T cells"
FT                   /note="Cw*0304 allele"
FT                   /db_xref="GOA:Q9UQT2"
FT                   /db_xref="IMGT/HLA:C*03:04:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q9UQT2"
FT                   /protein_id="CAB37943.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEA"
XX
SQ   Sequence 270 BP; 53 A; 83 C; 99 G; 35 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccggccgc ggggagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer