Dbfetch

ID   AJ133473; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ133473;
XX
DT   01-MAR-1999 (Rel. 59, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-C gene, Cw*0304 allele, exon 3
XX
KW   HLA-C gene; HLA-Cw*0304 allele; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Dunn P.P.;
RT   ;
RL   Submitted (25-FEB-1999) to the INSDC.
RL   Dunn P.P., Immunogenetics, Uktssa, Fox Den Road, Stoke Gifford, Bristol
RL   BS34 8RR, UNITED KINGDOM.
XX
RN   [2]
RA   Bird T., Dunn P.P., Bunce M.;
RT   "Three new HLA class I alleles in an individual from Kenya";
RL   Unpublished.
XX
DR   MD5; 275e323ab768bd8a5e829f1eb7c29bad.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Kenya"
FT                   /db_xref="taxon:9606"
FT   exon            1..276
FT                   /gene="HLA-C"
FT                   /number=3
FT                   /note="Cw*0304 allele"
FT   CDS             <3..>276
FT                   /gene="HLA-C"
FT                   /standard_name="MHC class I antigen"
FT                   /product="human leucocyte antigen C"
FT                   /function="presents peptides to T cells"
FT                   /note="Cw*0304 allele"
FT                   /db_xref="GOA:Q9UQT1"
FT                   /db_xref="IMGT/HLA:C*03:04:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9UQT1"
FT                   /protein_id="CAB37942.1"
FT                   /translation="SHIIQRMYGCDVGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAA
FT                   DTAAQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLKNGKETLQRA"
XX
SQ   Sequence 276 BP; 54 A; 83 C; 101 G; 38 T; 0 other;
     ggtctcacat catccagagg atgtacggct gcgacgtggg gcccgacggg cgcctcctcc        60
     gcgggtatga ccagtacgcc tacgacggca aggattacat cgccctgaac gaggatctgc       120
     gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgaggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtgg ctccgcagat       240
     acctgaagaa tgggaaggag acgctgcagc gcgcgg                                 276
//