Dbfetch

ID   AJ131853; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ131853;
XX
DT   15-JAN-1999 (Rel. 58, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens HLA-B gene, B*08 allele (B*08HO), exon 3
XX
KW   HLA-B gene; HLA-B*08 allele; human lecocyte antigen B;
KW   major histocompatibilty complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Blasczyk R.;
RT   ;
RL   Submitted (23-DEC-1998) to the INSDC.
RL   Blasczyk R., Hannover Medical School, Department of Transfusion Medicine,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [3]
RX   DOI; 10.1034/j.1399-0039.2000.550115.x.
RX   PUBMED; 10703615.
RA   Elsner H.A., Blasczyk R.;
RT   "Identification of the novel allele HLA-B*0809 in a Caucasian individual:
RT   estimation of allogeneic potential between B*08 variants";
RL   Tissue Antigens 55(1):74-77(2000).
XX
DR   MD5; 8f92a59d2da20e128040d78a16d8b793.
DR   Ensembl-Gn; ENSG00000223532; homo_sapiens.
DR   Ensembl-Tr; ENST00000425848; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="B-982612"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="blood lymphocytes"
FT                   /tissue_type="A*01,68; B*08HO,4001"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>276
FT                   /gene="HLA-B"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /standard_name="MHC class I antigen"
FT                   /product="human lecocyte antigen B"
FT                   /function="antigen presenting molecule"
FT                   /note="B*08 allele (B*08HO)"
FT                   /db_xref="GOA:P30460"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*08:09"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1AGB"
FT                   /db_xref="PDB:1AGC"
FT                   /db_xref="PDB:1AGD"
FT                   /db_xref="PDB:1AGE"
FT                   /db_xref="PDB:1AGF"
FT                   /db_xref="PDB:1M05"
FT                   /db_xref="PDB:1MI5"
FT                   /db_xref="PDB:3FFC"
FT                   /db_xref="PDB:3SJV"
FT                   /db_xref="PDB:3SKM"
FT                   /db_xref="PDB:3SKO"
FT                   /db_xref="PDB:3SPV"
FT                   /db_xref="PDB:3X13"
FT                   /db_xref="PDB:3X14"
FT                   /db_xref="PDB:4QRP"
FT                   /db_xref="PDB:4QRQ"
FT                   /db_xref="PDB:4QRS"
FT                   /db_xref="PDB:4QRT"
FT                   /db_xref="PDB:4QRU"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30460"
FT                   /protein_id="CAA10522.1"
FT                   /translation="SHTWQTMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAA
FT                   DTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERA"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B*08 allele (B*08HO)"
XX
SQ   Sequence 276 BP; 54 A; 84 C; 103 G; 35 T; 0 other;
     ggtctcacac ttggcagacg atgtatggct gcgacgtggg gccggacggg cgcctcctcc        60
     gcgggcataa ccagtacgcc tacgacggca aggattacat cgccctgaac gaggacctgc       120
     gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgtggcgga gcaggacaga gcctacctgg agggcacgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggac acgctggagc gcgcgg                                 276
//