spacer

EBI Dbfetch

ID   AJ131852; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ131852;
XX
DT   15-JAN-1999 (Rel. 58, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B gene, B*08 allele (B*08HO), exon 2
XX
KW   HLA-B gene; HLA-B*08 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Blasczyk R.;
RT   ;
RL   Submitted (23-DEC-1998) to the INSDC.
RL   Blasczyk R., Hannover Medical School, Department of Transfusion Medicine,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [2]
RX   DOI; 10.1034/j.1399-0039.2000.550115.x.
RX   PUBMED; 10703615.
RA   Elsner H.A., Blasczyk R.;
RT   "Identification of the novel allele HLA-B*0809 in a Caucasian individual:
RT   estimation of allogeneic potential between B*08 variants";
RL   Tissue Antigens 55(1):74-77(2000).
XX
DR   MD5; cc86d260a51350e819f4c866ded2658a.
DR   Ensembl-Gn; ENSG00000223532; homo_sapiens.
DR   Ensembl-Tr; ENST00000425848; homo_sapiens.
DR   Ensembl-Tr; ENST00000445222; homo_sapiens.
DR   Ensembl-Tr; ENST00000461583; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="B-982612"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="blood lymphocytes"
FT                   /tissue_type="A*01,68; B*08HO,4001"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>270
FT                   /gene="HLA-B"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /standard_name="MHC class I antigen"
FT                   /product="human leucocyte antigen B"
FT                   /function="antigen presenting molecule"
FT                   /note="B*08 allele (B*08HO)"
FT                   /db_xref="GOA:Q9UE96"
FT                   /db_xref="IMGT/HLA:B*08:09"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q9UE96"
FT                   /protein_id="CAA10521.1"
FT                   /translation="SHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*08 allele (B*08HO)"
XX
SQ   Sequence 270 BP; 60 A; 85 C; 90 G; 35 T; 0 other;
     gctcccactc catgaggtat ttcgacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer