spacer

EBI Dbfetch

ID   AJ011884; SV 1; linear; genomic DNA; STD; HUM; 120 BP.
XX
AC   AJ011884;
XX
DT   07-JAN-2000 (Rel. 62, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I gene, C-locus, exon 5, isolate ap, partial
XX
KW   HLA class I locus C; human leucocyte antigen; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-120
RA   van den Berg-Loonen E.;
RT   ;
RL   Submitted (07-OCT-1998) to the INSDC.
RL   van den Berg-Loonen E., Tissue Typing Laboratory, University Hospital
RL   Maastricht, P.O. Box 5800, 6202AZ Maastricht, 6202AZ Maastricht, THE
RL   NETHERLANDS.
XX
RN   [2]
RX   DOI; 10.1034/j.1399-0039.1999.540208.x.
RX   PUBMED; 10488744.
RA   van der Vlies S.A., Voorter C.E., van den Berg-Loonen E.M.;
RT   "There is more to HLA-C than exons 2 and 3: sequencing exons 1, 4 and 5";
RL   Tissue Antigens 54(2):169-177(1999).
XX
DR   MD5; c989e1470606d29b48847de622b231eb.
DR   Ensembl-Gn; ENSG00000225691; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237022; homo_sapiens.
DR   Ensembl-Tr; ENST00000414249; homo_sapiens.
DR   Ensembl-Tr; ENST00000419135; homo_sapiens.
DR   Ensembl-Tr; ENST00000419590; homo_sapiens.
DR   Ensembl-Tr; ENST00000429840; homo_sapiens.
DR   Ensembl-Tr; ENST00000433153; homo_sapiens.
DR   Ensembl-Tr; ENST00000438171; homo_sapiens.
DR   Ensembl-Tr; ENST00000453809; homo_sapiens.
DR   Ensembl-Tr; ENST00000457903; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..120
FT                   /organism="Homo sapiens"
FT                   /isolate="ap"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphocytes"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>120
FT                   /codon_start=3
FT                   /gene="MHC class I"
FT                   /product="MHC class I antigen"
FT                   /note="C-locus"
FT                   /db_xref="IMGT/HLA:C*03:02:01"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TNZ7"
FT                   /protein_id="CAB65548.1"
FT                   /translation="PSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSS"
FT   exon            1..120
FT                   /gene="MHC class I"
FT                   /number=5
XX
SQ   Sequence 120 BP; 16 A; 34 C; 39 G; 31 T; 0 other;
     agccgtcttc ccagcccacc atccccatcg tgggcatcgt tgctggcctg gctgtcctgg        60
     ctgtcctagc tgtcctagga gctgtggtgg ctgttgtgat gtgtaggagg aagagctcag       120
//


spacer
spacer