spacer

EBI Dbfetch

ID   AJ009755; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ009755;
XX
DT   24-JUL-1998 (Rel. 56, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiena MHC class II HLA-DR4 gene, DRB1*0431 allele, exon 2
XX
KW   class II; HLA-DR4; HLA-DRB1*0431 allele; human leucocyte antigen;
KW   major histocompatability complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1034/j.1399-0039.1999.530409.x.
RX   PUBMED; 10323343.
RA   Bettens F., Kervaire B., Tiercy J.M.;
RT   "Sequence of HLA-DRB1*0431 allele";
RL   Tissue Antigens 53(4 Pt 1):378-380(1999).
XX
RN   [2]
RP   1-270
RA   Tiercy J.M.;
RT   ;
RL   Submitted (21-JUL-1998) to the INSDC.
RL   Tiercy J.-M., Centre Medical Universitaire, Transplantation Immunology
RL   Unit, 1 rue Michel Servet, 1211 Geneva 4, Switzerland.
XX
DR   MD5; 94b34a2bbaec6d11248bff53a9ecdfe2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="A2,A31;B18,B51;Cw*0701,Cw*15;DRB1*1602,
FT                   DRB1*0431;DRB4*01;DRB5*02;DQB1*0301,DQB1*502"
FT                   /cell_line="GE47192"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DR4"
FT                   /note="allele HLA-DRB1*0431"
FT                   /db_xref="GOA:O77963"
FT                   /db_xref="IMGT/HLA:DRB1*04:31"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:O77963"
FT                   /protein_id="CAA08810.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQRRALVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DR4"
FT                   /number=2
FT                   /note="allele HLA-DRB1*0431"
XX
SQ   Sequence 270 BP; 59 A; 65 C; 97 G; 49 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccctgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer