spacer

EBI Dbfetch

ID   AJ007603; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ007603;
XX
DT   06-JUL-1998 (Rel. 56, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens HLA-B*15UL gene, exon 2 (and joined mRNA and CDS, partial)
XX
KW   HLA-B*15UL gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Blasczyk R.;
RT   ;
RL   Submitted (03-JUL-1998) to the INSDC.
RL   Blasczyk R., Charite, Campus Virchow-Klinikum, Humboldt-University, Blood
RL   Bank, Department of Hematology and Oncology, Augustenburger Platz 1,
RL   Berlin, 13353, GERMANY.
XX
RN   [2]
RX   DOI; 10.1034/j.1399-0039.2000.550118.x.
RX   PUBMED; 10703618.
RA   Elsner H.A., Woelpl A., Goldmann S.F., Blasczyk R.;
RT   "Identification of the novel allele HLA-B*1546 which belongs to the
RT   serological B72 type: implications for bone marrow transplantation";
RL   Tissue Antigens 55(1):83-85(2000).
XX
DR   MD5; c21476a09ac35370959a72b3e7dd42af.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="p21"
FT                   /isolate="UL980790"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="blood lymphocytes"
FT                   /tissue_type="A*02,30;B*15UL,35;Cw*0303,04"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,AJ007604.1:1..>276)
FT                   /gene="HLA-B*15UL"
FT   CDS             join(<1..270,AJ007604.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-B*15UL"
FT                   /product="HLA-B15UL protein"
FT                   /db_xref="GOA:O78169"
FT                   /db_xref="IMGT/HLA:B*15:46"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O78169"
FT                   /protein_id="CAA07578.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B*15UL"
FT                   /number=2
XX
SQ   Sequence 270 BP; 61 A; 86 C; 88 G; 35 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer