spacer

EBI Dbfetch

ID   AJ002678; SV 1; linear; mRNA; STD; HUM; 619 BP.
XX
AC   AJ002678;
XX
DT   18-NOV-1997 (Rel. 53, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Homo sapiens HLA-A gene, exons 1 2 and 3, A*7403
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Revised by [2]
RA   Blasczyk R.;
RT   ;
RL   Submitted (06-NOV-1997) to the INSDC.
RL   Blasczyk R., Bloodbank, Virchow-Klinikum, Humboldt-University, Dep. of
RL   Internal Medicine, Div. of Hematology and Oncology, Augustenburger Platz 1,
RL   13353 Berlin, 13353, GERMANY.
XX
RN   [2]
RP   1-619
RA   Blasczyk R.;
RT   ;
RL   Submitted (16-JAN-1998) to the INSDC.
RL   Blasczyk R., Bloodbank, Virchow-Klinikum, Humboldt-University, Dep. of
RL   Internal Medicine, Div. of Hematology and Oncology, Augustenburger Platz 1,
RL   13353 Berlin, 13353, GERMANY.
XX
RN   [3]
RX   DOI; 10.1111/j.1399-0039.1996.tb02630.x.
RX   PUBMED; 8896180.
RA   Blasczyk R., Wehling J., Onaldi-Mohr D., Rebmann V., Chandanayingyong D.,
RA   Grosse-Wilde H.;
RT   "Structural definition of the A*74 group: implications for matching in bone
RT   marrow transplantation with alternative donors";
RL   Tissue Antigens 48(3):205-209(1996).
XX
DR   MD5; 769da4d122723b60c32bcf0027f1ed8f.
DR   Ensembl-Gn; ENSG00000223980; homo_sapiens.
DR   Ensembl-Tr; ENST00000454091; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..619
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="971723"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /cell_type="blood lymphocytes"
FT                   /rearranged
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,74..343,344..>619)
FT                   /gene="HLA-A"
FT                   /product="signal peptide alpha1 and alpha2 domain"
FT                   /db_xref="GOA:P30459"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*74:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30459"
FT                   /protein_id="CAA05681.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTRAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAHSQTDRVDLAT
FT                   LRGYYNQSEAGSHTIQMMYGCDVGPDGRLLRGYQQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRT"
FT   exon            1..73
FT                   /gene="HLA-A"
FT                   /number=1
FT   exon            74..343
FT                   /gene="HLA-A"
FT                   /number=2
FT   exon            344..619
FT                   /gene="HLA-A"
FT                   /number=3
XX
SQ   Sequence 619 BP; 115 A; 194 C; 219 G; 91 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct tgggggccct ggccctgacc        60
     cagaccaggg cgggctccca ctccatgagg tatttcttca catccgtgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt cgtgcggttt       180
     gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggaccagga gacacggaat gtgaaggccc actcacagac tgaccgagtg       300
     gacctggcga ccctgcgcgg ctactacaac cagagcgagg ccggttctca caccatccag       360
     atgatgtatg gctgcgacgt ggggccggac gggcgcctcc tccgcgggta ccagcaggac       420
     gcctacgacg gcaaggatta catcgccttg aacgaggacc tgcgctcttg gaccgcggcg       480
     gacatggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagttg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcacgg                                                    619
//


spacer
spacer