spacer

EBI Dbfetch

ID   AJ002677; SV 1; linear; mRNA; STD; HUM; 546 BP.
XX
AC   AJ002677;
XX
DT   18-NOV-1997 (Rel. 53, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Homo sapiens HLA-B gene, exons 2 and 3, B*4202
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RA   Blasczyk R.;
RT   ;
RL   Submitted (06-NOV-1997) to the INSDC.
RL   Blasczyk R., Bloodbank, Virchow-Klinikum, Humboldt-University, Dep. of
RL   Internal Medicine, Div. of Hematology and Oncology, Augustenburger Platz 1,
RL   13353 Berlin, 13353, GERMANY.
XX
DR   MD5; c56de1a3e61a3f6bfd2b222172d4d28a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="mRNA"
FT                   /cell_type="blood lymphocytes"
FT                   /rearranged
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,271..>546)
FT                   /codon_start=3
FT                   /gene="HLA-B*4202"
FT                   /product="HLA-B*4202 alpha1 and alpha2 domains"
FT                   /db_xref="GOA:O19646"
FT                   /db_xref="IMGT/HLA:B*42:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O19646"
FT                   /protein_id="CAA05680.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTC
FT                   VEWLRRYLENGKDTLERA"
FT   mat_peptide     join(<1..270,271..>546)
FT                   /gene="HLA-B*4202"
FT                   /product="HLA-B*4202 alpha1 and alpha2 domains"
FT   exon            1..270
FT                   /gene="HLA-B*4202"
FT                   /number=2
FT   exon            271..546
FT                   /gene="HLA-B*4202"
FT                   /number=3
XX
SQ   Sequence 546 BP; 111 A; 175 C; 192 G; 68 T; 0 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacac cctccagagc atgtacggct       300
     gcgacgtggg gccggacggg cgcctcctcc gcgggcataa ccagtacgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctgc gctcctggac cgcggcggac accgcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcaggacaga gcctacctgg       480
     agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggac acgctggagc       540
     gcgcgg                                                                  546
//


spacer
spacer