spacer

EBI Dbfetch

ID   AJ002534; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ002534;
XX
DT   27-NOV-1998 (Rel. 57, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-E gene exon 3
XX
KW   HLA-E gene; human leukocyte antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Steffensen R.;
RT   ;
RL   Submitted (31-OCT-1997) to the INSDC.
RL   Steffensen R., Aalborg Sygehus, Department of Clinical Immunology and Blood
RL   Transfusion, 9000 Aalborg, DENMARK.
XX
RN   [3]
RX   DOI; 10.1111/j.1399-0039.1998.tb03088.x.
RX   PUBMED; 9894856.
RA   Steffensen R.;
RT   "HLA-E allele detected in a Danish population and in a group of patients
RT   with multiple spontaneous abortions";
RL   Tissue Antigens 52(6):569-572(1998).
XX
DR   MD5; ec7a8c0740e0ef94988dc7523fecdccd.
DR   Ensembl-Gn; ENSG00000206493; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229252; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230254; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233904; homo_sapiens.
DR   Ensembl-Tr; ENST00000383597; homo_sapiens.
DR   Ensembl-Tr; ENST00000415289; homo_sapiens.
DR   Ensembl-Tr; ENST00000415649; homo_sapiens.
DR   Ensembl-Tr; ENST00000427936; homo_sapiens.
DR   Ensembl-Tr; ENST00000616124; homo_sapiens.
DR   Ensembl-Tr; ENST00000617749; homo_sapiens.
DR   Ensembl-Tr; ENST00000618827; homo_sapiens.
DR   Ensembl-Tr; ENST00000621113; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            1..276
FT                   /gene="HLA-E"
FT                   /number=3
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-E"
FT                   /note="PCR product confirmed by sequencing analysis"
FT                   /db_xref="GOA:Q9TNU7"
FT                   /db_xref="IMGT/HLA:E*01:03:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TNU7"
FT                   /protein_id="CAA05527.1"
FT                   /translation="SHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAV
FT                   DTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHL"
XX
SQ   Sequence 276 BP; 63 A; 79 C; 88 G; 46 T; 0 other;
     ggtctcacac cctgcagtgg atgcatggct gcgagctggg gcccgacagg cgcttcctcc        60
     gcgggtatga acagttcgcc tacgacggca aggattatct caccctgaat gaggacctgc       120
     gctcctggac cgcggtggac acggcggctc agatctccga gcaaaagtca aatgatgcct       180
     ctgaggcgga gcaccagaga gcctacctgg aagacacatg cgtggagtgg ctccacaaat       240
     acctggagaa ggggaaggag acgctgcttc acctgg                                 276
//


spacer
spacer