spacer

EBI Dbfetch

ID   AJ002533; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ002533;
XX
DT   27-NOV-1998 (Rel. 57, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-E gene exon 2
XX
KW   HLA-E gene; human leukocyte antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Steffensen R.;
RT   ;
RL   Submitted (31-OCT-1997) to the INSDC.
RL   Steffensen R., Aalborg Sygehus, Department of Clinical Immunology and Blood
RL   Transfusion, 9000 Aalborg, DENMARK.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.1998.tb03088.x.
RX   PUBMED; 9894856.
RA   Steffensen R.;
RT   "HLA-E allele detected in a Danish population and in a group of patients
RT   with multiple spontaneous abortions";
RL   Tissue Antigens 52(6):569-572(1998).
XX
DR   MD5; c002033e66f74b372a87f1ca10baee4d.
DR   Ensembl-Gn; ENSG00000204592; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206493; homo_sapiens.
DR   Ensembl-Gn; ENSG00000225201; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229252; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230254; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233904; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236632; homo_sapiens.
DR   Ensembl-Tr; ENST00000376630; homo_sapiens.
DR   Ensembl-Tr; ENST00000383597; homo_sapiens.
DR   Ensembl-Tr; ENST00000415289; homo_sapiens.
DR   Ensembl-Tr; ENST00000415649; homo_sapiens.
DR   Ensembl-Tr; ENST00000425603; homo_sapiens.
DR   Ensembl-Tr; ENST00000427936; homo_sapiens.
DR   Ensembl-Tr; ENST00000444683; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-E"
FT                   /number=2
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /note="PCR product derived from human genomic DNA,
FT                   confirmed by sequence analysis"
FT                   /db_xref="GOA:Q9TNU8"
FT                   /db_xref="IMGT/HLA:E*01:03:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TNU8"
FT                   /protein_id="CAA05526.1"
FT                   /translation="SHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMV
FT                   PRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEA"
XX
SQ   Sequence 270 BP; 49 A; 85 C; 92 G; 44 T; 0 other;
     gctcccactc cttgaagtat ttccacactt ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc tgtgggctac gtggacgaca cccagttcgt gcgcttcgac aacgacgccg       120
     cgagtccgag gatggtgccg cgggcgccgt ggatggagca ggaggggtca gagtattggg       180
     accgggagac acggagcgcc agggacaccg cacagatttt ccgagtgaac ctgcggacgc       240
     tgcgcggcta ctacaatcag agcgaggccg                                        270
//


spacer
spacer