spacer

EBI Dbfetch

ID   AF549410; SV 1; linear; genomic DNA; STD; HUM; 265 BP.
XX
AC   AF549410;
XX
DT   24-AUG-2003 (Rel. 77, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DBP1) gene, HLA-DBP1*9501 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-265
RX   DOI; 10.1034/j.1399-0039.2003.00066.x.
RX   PUBMED; 12890000.
RA   Luo M., Ramdahin S., Iqbal S., Pan Y., Jacobson K., Narayansingh M.J.,
RA   Schroeder M., Brunham R.C., Embree J., Plummer F.A.;
RT   "High resolution sequence-based DPB1 typing identified two novel DPB1
RT   alleles, DPB1*9401 and DPB1*9501, from a Kenyan population";
RL   Tissue Antigens 62(2):182-184(2003).
XX
RN   [2]
RP   1-265
RA   Luo M., Ramdahin S., Iqbal S., Jacobson K., Narayansingh M., Schroeder M.,
RA   Embree J., Brunham R., Plummer F.;
RT   ;
RL   Submitted (02-OCT-2002) to the INSDC.
RL   Medical Microbiology, University of Manitoba, 730 William Ave., Winnipeg,
RL   Manitoba R3E 0W3, Canada
XX
DR   MD5; 778cc4049e784271a9c5a6af62b6ba92.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..265
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>265
FT                   /gene="HLA-DBP1"
FT                   /allele="DBP1*9501"
FT   mRNA            <1..>265
FT                   /gene="HLA-DBP1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>265
FT                   /codon_start=1
FT                   /gene="HLA-DBP1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*95:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="PDB:4P4K"
FT                   /db_xref="PDB:4P4R"
FT                   /db_xref="PDB:4P57"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="AAQ12564.1"
FT                   /translation="RITFSQGRQECYAFNGTQRFLERYIYNREELVRFDSDVGEFRAVT
FT                   ELGRPAAEYWNSQKDLLEEERAVPDRMCRHNYELGGPMTLQRR"
FT   exon            <1..>265
FT                   /gene="HLA-DBP1"
FT                   /number=2
XX
SQ   Sequence 265 BP; 58 A; 69 C; 98 G; 40 T; 0 other;
     agaattacct tttcccaggg acggcaggaa tgctacgcgt ttaatgggac acagcgcttc        60
     ctggagagat acatctacaa ccgggaggag ctcgtgcgct tcgacagcga cgtgggggag       120
     ttccgggcgg tgacggagct ggggcggcct gctgcggagt actggaacag ccagaaggac       180
     ctcctggagg aggagcgggc agtgccggac aggatgtgca gacacaacta cgagctgggc       240
     gggcccatga ccctgcagcg ccgag                                             265
//


spacer
spacer