Dbfetch

ID   AH011818; SV 3; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH011818; AF538309; AF541998;
XX
DT   08-JUL-2011 (Rel. 109, Created)
DT   08-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-Cw*0701new allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Klink I.M., Montoya G.D., Wu J., Williams T.M.;
RT   "Novel human HLA-C allele identified in potential bone marrow donors";
RL   Unpublished.
XX
RN   [2]
RP   1-646
RA   Klink I.M., Montoya G.D., Wu J., Williams T.M.;
RT   ;
RL   Submitted (08-AUG-2002) to the INSDC.
RL   Pathology, University of New Mexico, 915 Camino de Salud, Albuquerque, NM
RL   87131, USA
XX
DR   MD5; 0e55b55f4a971b26cb03b19e19becd3f.
XX
CC   On or before Jul 7, 2011 this sequence version replaced
CC   gi:22759014, gi:22759140, gi:22902102.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /map="6p23"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p23"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   source          371..646
FT                   /organism="Homo sapiens"
FT                   /map="6p23"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0701new"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0701new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0701new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HWT1"
FT                   /protein_id="AAN10166.1"
FT                   /translation="SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQNYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0701new"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0701new"
FT                   /number=3
XX
SQ   Sequence 646 BP; 105 A; 173 C; 197 G; 71 T; 100 other;
     gctcccactc catgaggtat ttcgacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaactac aagcgccagg cacaggctga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtatggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac accgcggctc agatcaccca gcgcaagttg       540
     gaggcggccc gtgcggcgga gcagctgaga gcctacctgg agggtacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcag                      646
//