spacer

EBI Dbfetch

ID   AF523298; SV 1; linear; genomic DNA; STD; HUM; 5574 BP.
XX
AC   AF523298;
XX
DT   03-JUL-2002 (Rel. 72, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens clone SCHU MHC class Ib antigen (HLA-G) gene, HLA-G*01011
DE   allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-5574
RX   DOI; 10.1007/s00251-005-0076-z.
RX   PUBMED; 16570139.
RA   Pyo C.W., Williams L.M., Moore Y., Hyodo H., Li S.S., Zhao L.P.,
RA   Sageshima N., Ishitani A., Geraghty D.E.;
RT   "HLA-E, HLA-F, and HLA-G polymorphism: genomic sequence defines haplotype
RT   structure and variation spanning the nonclassical class I genes";
RL   Immunogenetics 58(4):241-251(2006).
XX
RN   [2]
RP   1-5574
RA   Ishitani A., Miki A., Williams L.M., Moore Y., Geraghty D.E.;
RT   ;
RL   Submitted (21-JUN-2002) to the INSDC.
RL   Clinical Division, Fred Hutchinson Cancer Research Center, 1100 Fairview
RL   Ave. N., D4-100, Seattle, WA 98109-1024, USA
XX
DR   MD5; 7c3950507310846285dcaa2c0cec1b55.
DR   Ensembl-Gn; ENSG00000204632; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206506; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230413; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233095; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235346; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235680; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237216; homo_sapiens.
DR   Ensembl-Tr; ENST00000360323; homo_sapiens.
DR   Ensembl-Tr; ENST00000376828; homo_sapiens.
DR   Ensembl-Tr; ENST00000383621; homo_sapiens.
DR   Ensembl-Tr; ENST00000400665; homo_sapiens.
DR   Ensembl-Tr; ENST00000400682; homo_sapiens.
DR   Ensembl-Tr; ENST00000420559; homo_sapiens.
DR   Ensembl-Tr; ENST00000422371; homo_sapiens.
DR   Ensembl-Tr; ENST00000423011; homo_sapiens.
DR   Ensembl-Tr; ENST00000423373; homo_sapiens.
DR   Ensembl-Tr; ENST00000428701; homo_sapiens.
DR   Ensembl-Tr; ENST00000428952; homo_sapiens.
DR   Ensembl-Tr; ENST00000434881; homo_sapiens.
DR   Ensembl-Tr; ENST00000444098; homo_sapiens.
DR   Ensembl-Tr; ENST00000449127; homo_sapiens.
DR   Ensembl-Tr; ENST00000450984; homo_sapiens.
DR   Ensembl-Tr; ENST00000546545; homo_sapiens.
DR   Ensembl-Tr; ENST00000546634; homo_sapiens.
DR   Ensembl-Tr; ENST00000547241; homo_sapiens.
DR   Ensembl-Tr; ENST00000547931; homo_sapiens.
DR   Ensembl-Tr; ENST00000550897; homo_sapiens.
DR   Ensembl-Tr; ENST00000553052; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5574
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /clone="SCHU"
FT                   /db_xref="taxon:9606"
FT   gene            <1202..>4127
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*01011"
FT   mRNA            join(<1202..1274,1404..1673,1900..2175,2775..3050,
FT                   3173..3289,3735..3766,4123..>4127)
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*01011"
FT                   /product="MHC class Ib antigen"
FT   CDS             join(1202..1274,1404..1673,1900..2175,2775..3050,
FT                   3173..3289,3735..3739)
FT                   /codon_start=1
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*01011"
FT                   /product="MHC class Ib antigen"
FT                   /db_xref="GOA:Q6DU14"
FT                   /db_xref="IMGT/HLA:G*01:01:01:05"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DU14"
FT                   /protein_id="AAM74993.1"
FT                   /translation="MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPR
FT                   FIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQT
FT                   LRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTA
FT                   AQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYE
FT                   ATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD"
XX
SQ   Sequence 5574 BP; 1236 A; 1439 C; 1530 G; 1364 T; 5 other;
     gaggaaagaa ttccaaagca gcagaactct taggtttaaa cacattgttt tatagatttt        60
     aatacatcca tctacagagc ctcgctgggt gttctttgca gttggccttt aatatcttat       120
     gtgggtctgc ctagaaacta attgtttttt atgttaatca ggtttaaaaa atactaagta       180
     ttcctaaaaa atatacactc cactcacatg tggatacttc ctaaaaacag gcagtgcgtg       240
     agcactagtg aggggcattg tgactgcact gaacacttac aactgtgagg tgaataaagt       300
     ttgtgctggc tcctggttgc aacatatagt aacatagtgt ggtactttgt cttgaggaga       360
     tgtcctggac tcacacggaa acttagggct acggaatgaa ggtaaattta aaataaaaca       420
     agcgggagtc acagatacac tgtctgggaa agtgaaactt aagagctttg tgagtcgtgt       480
     tgtaatgctt ttagatgcat ttatatacca acaggccaaa gtcacatttt ttaccgatta       540
     gattcctgat cattcagggg ttaccaaggt tatgctaccc actatagtta ataaacaaaa       600
     agcaaactgg tctctattct atctcatgca ctcaggcaca acttttccag atttaagggg       660
     gaaaaaaaac cctgtcttta cacctacaat cccagggcga gctcactctc tggcaacaag       720
     ctccctgggg tgatttttct tctagaagag tacaggagga caggcaagga gtgggaggca       780
     gggagtccag ttcagggaca gggattccgg gatgaaaagt gaagggagag ggccagggac       840
     cttgccgagg gtttctccct ggtttctcag acagctcctg ggccaagact cagggagaca       900
     ctgagacaga acgcttggca caagagtagc ggggtcaggg cgaagtccca gggcctcaag       960
     cgtggctctc agggtctcag gccccacagg cggtgtatgg gttggggagg ccccgcgttg      1020
     gggattctct cctccttctc ctaacctgtg tcgggtcctt cttcctggat actcaccggg      1080
     cggccccagt tctcactccc attaggtgac aggtttttag agaagccaat cagcgtcgcc      1140
     gcggtcctgg ttctaaagtc ctcgctcacc cacccggact cattctcccc agacgccaag      1200
     gatggtggtc atggcgcccc gaaccctctt cctgctgctc tcgggggccc tgaccctgac      1260
     cgagacctgg gcgggtgagt gcggggtcag gagggaaaca gcccctgcgc ggaggaggga      1320
     ggggccggcc cggcgggggc gcaggactcg gcagccgcgc cgggaggagg gtcgggcggg      1380
     tctcaacccc tcctcgcccc caggctccca ctccatgagg tatttcagcg ccgccgtgtc      1440
     ccggcccggc cgcggggagc cccgcttcat cgccatgggc tacgtggacg acacgcagtt      1500
     cgtgcggttc gacagcgact cggcgtgtcc gaggatggag ccgcgggcgc cgtgggtgga      1560
     gcaggagggg ccggagtatt gggaagagga gacacggaac accaaggccc acgcacagac      1620
     tgacagaatg aacctgcaga ccctgcgcgg ctactacaac cagagcgagg ccagtgagta      1680
     actccggccc agggagcaga tcacgacccc cacctccatg ccccacggac ggcccgggta      1740
     ctcccgagtc tccgggtctg ggatccaccc cgaggccgcg ggacccgccc agaccctcta      1800
     cctgggagaa ccccaaggcg cctttaccaa aatccccgcg ggtgggtccg ggcgagggcg      1860
     aggctcggtg ggcggggctg accgaggggg tggggccagg ttctcacacc ctccagtgga      1920
     tgattggctg cgacctgggg tccgacggac gcctcctccg cgggtatgaa cagtatgcct      1980
     acgatggcaa ggattacctc gccctgaacg aggacctgcg ctcctggacc gcagcggaca      2040
     ctgcggctca gatctccaag cgcaagtgtg aggcggccaa tgtggctgaa caaaggagag      2100
     cctacctgga gggcacgtgc gtggagtggc tccacagata cctggagaac gggaaggaga      2160
     tgctgcagcg cgcgggtacc aggggcagtg gggcgcctcc ctgatctcct gtagacctct      2220
     cagcctggcc tagcacaagg agaggaggaa aatgggacca acactagaat atcgccctcc      2280
     ctctggtcct gagggagagg aatcctcctg ggtttccaga tcctgtacca gagagtgatt      2340
     ctgagggtcc gtcctgctct ctgggacaat taagggatga agtctctgag ggagtggagg      2400
     ggaagacaat ccctggaaga ctgatcaggg gttccctttg accccacagc agccttggca      2460
     ccaggacttt tcccctcagg ccttgttctc tgcctcacac tcaatgtgtg tgggggtctg      2520
     actccagctc ctctgagtcc cttggcctcc actcaggtca gaaccggagg tccctgctcc      2580
     cccgctcaga gactagaact ttccaaggaa taggagatta tcccaggtgc ccgtgtccag      2640
     gctggtgtct gggttctgtg ctcccttccc caccccaggt atctggttca ttcttaggat      2700
     ggtcacatcc aggtgctgct ggagtgtccc atgagagatg caaagtgctt gaattttctg      2760
     actcttcctt tcagaccccc ccaagacaca cgtgacccac caccctgtct ttgactatga      2820
     ggccaccctg aggtgctggg ccctgggctt ctaccctgcg gagatcatac tgacctggca      2880
     gcgggatggg gaggaccaga cccaggacgt ggagctcgtg gagaccaggc ctgcagggga      2940
     tggaaccttc cagaagtggg cagctgtggt ggtgccttct ggagaggagc agagatacac      3000
     gtgccatgtg cagcatgagg ggctgccgga gcccctcatg ctgagatgga gtaaggaggg      3060
     agatggaggc atcatgtctg ttagggaaag caggagcctc tctgaagacc tttaacaggg      3120
     tcggtggtga gggctggggg tcagagaccc tcaccttcac ctcctttccc agagcagtct      3180
     tccctgccca ccatccccat catgggtatc gttgctggcc tggttgtcct tgcagctgta      3240
     gtcactggag ctgcggtcgc tgctgtgctg tggagaaaga agagctcagg taaggaaggg      3300
     gtgacaagtg gggtctgagt tttcttgtcc cactgggggt ttcaagcccc aggtagaagt      3360
     gtgccctgcc tggttactgg gaagcaccat ccacactcat gggcctaccc agcctgggcc      3420
     ctgtgtgcca gcaccttctc ttttgtaaag cacctgtgac aatgaaggac agatttatta      3480
     ccttgatgat tgtagtgatg gggacctgat cccagtaatc acaggtcagg agaaggtccc      3540
     tggctaagga cagaccttag gagggcagtt ggtcgaggac ccacatctgc tttccttgtt      3600
     tttcctgatc ccgccctggg tctgcagtca cacatttctg gaaacttctc gagggtccaa      3660
     gactaggagg ttcctctagg acctcatggc cctgccacct ttctggcctc tcacaggaca      3720
     ttttcttccc acagattgaa aaggagggag ctactctcag gctgcaagta agtatgaagg      3780
     aggctgatcc ctgagatcct tgggatcttg tgtttgggag cccatggggg agctcaccca      3840
     ccccacaatt cctcctctgg ccacatctcc tgtggtctct gaccaggtgc tgtttttgtt      3900
     ctactctagg cagtgacagt gcccagggct ctaatgtgtc tctcacggct tgtaaatgtg      3960
     acaccccggg gggcctgatg tgtgtgggtt gttgagggga acaggggaca tagctgtgct      4020
     atgaggtttc tttcacttga atgtattgag catgtgatgg gctgtttaaa gtgtcacccc      4080
     tcactgtgac tgatatgaat ttgttcatga atatttttct gtagtgtgaa acagctgccc      4140
     tgtgtgggac tgagtggcaa gtccctttgt gacttcaaga accctgactc ctctttgtgc      4200
     agagaccagc ccacccctgt gcccaccatg accctcttcc tcatgctgaa ctgcattcct      4260
     tccccaatca cctttcctgt tccagaaaag gggctgggat gtctccgtct ctgtctcaaa      4320
     tttgtggtcc actgagctat aacttacttc tgtattaaaa ttagaatctg agtataaatt      4380
     tactttttca aattatttcc aagagagatt gatgggttaa ttaaaggaga agattcctga      4440
     aatttgagag acaaaataaa tggaagacat gagaactttc cacagtacac gtgtttcttg      4500
     tgctgatttg ttgcaggaga ggagagtaga tggggctgcg cccagtgggt gctcaggcca      4560
     ccatgaactt tatgtggtca ctgctcagct gggtcatctt tgctgctcca ttgtccttgg      4620
     cccttcagta gaaccttgtc ccaccaggac ctgtgatcac atagacttgg atatcaccta      4680
     ggatggtccc tacacgtaga agttcctgtg ttatcagaag aaaaattttc agacccctac      4740
     acctcttccc ctccttccag gtctctttca attgtatttt ccatcttttt tttttttttn      4800
     nnnntttttt tttttttttt tttgagatgg actctcactc aggctggagt gcagtggtgc      4860
     aatctcaact cattgcaacc tccacctccc gggttcaagc aattctcctg tctcagcctc      4920
     cctagtaact gggagtacag gcacatgcca caatacccag ctaatttttt gtatttttag      4980
     taaagacggg atttcaccat gttagccagg atggtcttga tctcctgacc ttgtgatctg      5040
     cccgcctctg cctcccaaag tgctgggatt acaggtgtga gccaccatgc ctggcttccc      5100
     caaccttctt aaaggaagca gattctgaaa cttcccgaga ggagaggtcc cagagttttt      5160
     cattgtagtt tactttctgt tggaactcct cttctgctct ctctcctact cttcttcctg      5220
     ccctgagttg tagtaatcct attgctggct ccaaaccaaa ctcatggatt tgtaaagcag      5280
     agtctaattt agattcatat gtggttggat aattggagcc ataagccttg ggttatcttt      5340
     cctcaagaga caaatatggt tgtgtgctgc agtgtgcagg aggattggtg tgggaggagg      5400
     gagggaggga ggacacaaaa gcagccctgg tgagaaaagc actggtgcat ttatatccac      5460
     atgagataat attgttccac agcggctaca aaatgacatt tggcctgagt ctacattaat      5520
     aaagatattg cctttagaat aggggggcgc actacagtaa tcatccattc aagt            5574
//


spacer
spacer