spacer

EBI Dbfetch

ID   AF518372; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AF518372;
XX
DT   28-NOV-2002 (Rel. 73, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Colomys goslingi specimen-voucher SMNS 30124 cytochrome b (cytb) gene,
DE   partial cds; mitochondrial gene for mitochondrial product.
XX
KW   .
XX
OS   Colomys goslingi (African water rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Colomys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RX   DOI; 10.1016/S1631-0691(02)01488-9.
RX   PUBMED; 12360851.
RA   Lecompte E., Granjon L., Peterhans J.K., Denys C.;
RT   "Cytochrome b-based phylogeny of the Praomys group (Rodentia, Murinae): a
RT   new African radiation?";
RL   C. R. Biol. 325(7):827-840(2002).
XX
RN   [2]
RP   1-1140
RA   Lecompte E., Granjon L., Kerbis Perterhans J.C., Denys C.;
RT   ;
RL   Submitted (05-JUN-2002) to the INSDC.
RL   Laboratoire Zoologie Mammiferes et Oiseaux, Museum National d'Histoire
RL   Naturelle, 55, rue Buffon, Paris 75005, France
XX
DR   MD5; 0ca861da00086ada56c5364480b96834.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Colomys goslingi"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Sudan: Gilo"
FT                   /specimen_voucher="SMNS 30124"
FT                   /db_xref="taxon:119564"
FT   CDS             1..>1140
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q8HNF7"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HNF7"
FT                   /protein_id="AAN75689.1"
FT                   /translation="MTNIRKTHPLFKIINHSFIDLPAPSNISSWWNFGSLLGICLMIQI
FT                   ITGLFLAMHYTSDTTTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGMYY
FT                   GSYTFMETWNIGVILLFTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIITALVIVHLLFLHETGSNNPTGLNSDSDKIPFHP
FT                   YYTIKDILGMIMMFMFLMILVLFFPDLLGNPXNYSPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALVLSILVLAFLPLLHTSKQRSLMFRPITQTLYWILVANLLILTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILILMPISGIIEDNMLKWY"
XX
SQ   Sequence 1140 BP; 375 A; 311 C; 129 G; 323 T; 2 other;
     atgacaaaca tccgaaaaac ccacccacta tttaaaatca tcaatcactc cttcattgac        60
     ctacccgccc catcgaacat ctcatcatga tgaaactttg gctcacttct aggaatctgc       120
     ctaataatcc aaatcatcac aggcttattc ttagcaatac attatacgtc agacacaact       180
     acagcatttt catcagtcac acatatctgc cgagacgtaa actatggatg actaatccga       240
     tatatacacg caaacggagc atcaatattc ttcatctgcc ttttcctaca tgtaggtcga       300
     ggcatatatt acggatccta tactttcata gaaacatgaa acattggagt cattttacta       360
     ttcacagtaa tagccaccgc attcataggc tacgtacttc catgaggaca aatatcattc       420
     tgaggtgcaa cagtaatcac aaatcttcta tcagcaattc catacatcgg aactacacta       480
     gtagaatgaa tctgaggagg attctcagtt gacaaagcta cattaacacg cttcttcgca       540
     ttccacttta ttctcccatt catcattaca gccctagtaa ttgtccacct cctatttctt       600
     cacgaaacag gatctaataa tcccacaggc cttaactcag actcagataa aatcccattc       660
     cacccatact acacaattaa agacatccta ggaataatca taatatttat attcctaata       720
     attctagtac tatttttccc agacttacta ggnaacccan acaactactc accagcaaat       780
     ccacttaaca ctccacccca catcaaacca gaatgatatt tcctatttgc ttacgctatc       840
     ctccgatcaa tccctaacaa acttggagga gtattagccc tagtcctatc cattctagtc       900
     ttagctttcc tacccctact tcatacatcc aaacaacgaa gcctaatatt ccgtcccatc       960
     acacaaaccc tatactgaat cttagtagct aatctactta ttctaacctg aatcggagga      1020
     caaccagtag aacacccatt tattattatt ggccaactag catcaatcag ttacttctcc      1080
     attatcctta ttctaatacc tatctcagga atcatcgaag acaacatact caaatgatac      1140
//


spacer
spacer