spacer

EBI Dbfetch

ID   AF518364; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AF518364;
XX
DT   28-NOV-2002 (Rel. 73, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Praomys misonnei specimen-voucher FMNH 149594 cytochrome b (cytb) gene,
DE   partial cds; mitochondrial gene for mitochondrial product.
XX
KW   .
XX
OS   Praomys misonnei
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Praomys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RX   DOI; 10.1016/S1631-0691(02)01488-9.
RX   PUBMED; 12360851.
RA   Lecompte E., Granjon L., Peterhans J.K., Denys C.;
RT   "Cytochrome b-based phylogeny of the Praomys group (Rodentia, Murinae): a
RT   new African radiation?";
RL   C. R. Biol. 325(7):827-840(2002).
XX
RN   [2]
RP   1-1140
RA   Lecompte E., Granjon L., Kerbis Perterhans J.C., Denys C.;
RT   ;
RL   Submitted (05-JUN-2002) to the INSDC.
RL   Laboratoire Zoologie Mammiferes et Oiseaux, Museum National d'Histoire
RL   Naturelle, 55, rue Buffon, Paris 75005, France
XX
DR   MD5; 05c1c41408462f8d1dd527d07ef18724.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Praomys misonnei"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Democratic Republic of the Congo: Epulu"
FT                   /specimen_voucher="FMNH 149594"
FT                   /db_xref="taxon:209867"
FT   CDS             1..>1140
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q8HNG5"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HNG5"
FT                   /protein_id="AAN75681.1"
FT                   /translation="MTNIRKTHPLFKIINHSFIDLPAPSNISSWWNFGSLLGICLMIQI
FT                   ITGLFLAMHYTSDTMTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYX
FT                   GSYTFMETWNIGVILLFTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIITALVFVHLLFLHETGSNNPTGLNSDSDKIPFHP
FT                   YYTIKDILGVIMMIMFLMTLVLFFPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALIMSILVLALLPFLHTSKQRSLMFRPIXQTLYWILVANLLVLTWMGG
FT                   QPVEHPFIIIGQLASISYFSIILIYMPMAGMXEDNMLKWN"
XX
SQ   Sequence 1140 BP; 375 A; 300 C; 137 G; 325 T; 3 other;
     atgacaaaca tccgaaaaac ccacccacta ttcaaaatta ttaaccattc tttcatcgac        60
     ctacctgccc cttcaaacat ttcatcatga tgaaacttcg gttcactact aggaatctgc       120
     ctaataattc aaatcatcac aggcctcttt ctagcaatac actatacatc agacacaata       180
     acagcatttt catcagtaac acatatctgc cgagacgtaa actacggatg actaatccga       240
     tatttacacg caaacggagc atcaatattt tttatttgcc tcttcctcca cgtaggacga       300
     ggaatatatn atggatctta tacctttata gaaacatgaa acattggagt catcttactc       360
     ttcacagtaa tagccactgc atttataggc tatgttctcc catgaggaca aatatcattc       420
     tgaggcgcaa cagttattac aaacttacta tcagcaattc catacatcgg aactacccta       480
     gtagagtgaa tctgaggagg gttctcagta gataaagcaa cactaacacg cttcttcgca       540
     tttcacttta tcctcccatt catcattaca gccctagttt ttgtccacct actattcctc       600
     catgaaacag gttctaataa tccaacaggc ctaaactctg actcagacaa aattccattt       660
     catccttatt atacaattaa agatattcta ggagtaatca taataattat attcttaata       720
     actctagtat tattttttcc agatttacta ggagacccag acaactacac accagctaac       780
     ccacttaaca ccccacctca tatcaaacca gaatgatatt tcctatttgc ctacgccatc       840
     ttacgatcta tccccaacaa actaggagga gtcctagcct taattatgtc tatcctagtc       900
     ctagccctcc taccattcct ccacacatcc aaacaacgaa gcctaatatt ccgtcccatc       960
     ncccaaactc tatactgaat cctagtagct aacctcctag tgttaacttg aataggaggt      1020
     caaccagtag aacacccatt catcatcatt ggacaactag catcgatcag ttacttctct      1080
     atcatcctga tctatatacc aatagcagga ataatngaag acaacatact caaatgaaac      1140
//


spacer
spacer