spacer

EBI Dbfetch

ID   AF518361; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AF518361;
XX
DT   28-NOV-2002 (Rel. 73, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Praomys jacksoni specimen-voucher FMNH 138095 cytochrome b (cytb) gene,
DE   partial cds; mitochondrial gene for mitochondrial product.
XX
KW   .
XX
OS   Praomys jacksoni
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Praomys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RX   DOI; 10.1016/S1631-0691(02)01488-9.
RX   PUBMED; 12360851.
RA   Lecompte E., Granjon L., Peterhans J.K., Denys C.;
RT   "Cytochrome b-based phylogeny of the Praomys group (Rodentia, Murinae): a
RT   new African radiation?";
RL   C. R. Biol. 325(7):827-840(2002).
XX
RN   [2]
RP   1-1140
RA   Lecompte E., Granjon L., Kerbis Perterhans J.C., Denys C.;
RT   ;
RL   Submitted (05-JUN-2002) to the INSDC.
RL   Laboratoire Zoologie Mammiferes et Oiseaux, Museum National d'Histoire
RL   Naturelle, 55, rue Buffon, Paris 75005, France
XX
DR   MD5; 3e787eaa989e094581abaa090403847a.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Praomys jacksoni"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Uganda: Kalanga"
FT                   /specimen_voucher="FMNH 138095"
FT                   /db_xref="taxon:209866"
FT   CDS             1..>1140
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q8HNG8"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HNG8"
FT                   /protein_id="AAN75678.1"
FT                   /translation="MTNXRKTHPLLKMINHSFIDLPAPSNISSWWNFGSLLGVCLMIQI
FT                   ITGLFLAMHYTSDTTTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGMYY
FT                   GSYAFMETWNIGVILLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIIAALVFVHLLFLHETGSNNPTGLNSDSDKIPFHP
FT                   YYTMKDILGVVMLIVFLMTLVLFFPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALVLSILVLAFLPFLHTSKQRSLMFRPITQILYWVLVANLLVLTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILILMPISGIIEDNMLKWN"
XX
SQ   Sequence 1140 BP; 357 A; 310 C; 144 G; 327 T; 2 other;
     atgacaaacn tccgnaaaac ccacccactt cttaaaataa ttaaccattc tttcattgac        60
     cttcctgccc catcaaatat ttcatcatga tgaaacttcg gctcactatt aggagtctgc       120
     ttaataatcc aaattatcac aggccttttc ctagctatac actacacatc agatacaaca       180
     acagcatttt catcagtaac acatatttgc cgagacgtaa actacggatg actaatccga       240
     tatatgcacg caaacggagc atcaatattc ttcatttgtc ttttcctcca tgtaggccga       300
     ggaatgtact atggatccta cgccttcata gaaacatgaa acatcggagt gatcttacta       360
     tttgcagtga tagctaccgc atttataggc tatgtcctcc catgaggaca aatatcattc       420
     tgaggggcaa cagtaattac aaatttacta tcagcaatcc catacattgg aactacccta       480
     gtagaatgaa tctgaggagg cttctcagta gataaagcaa ccctaacacg cttcttcgca       540
     tttcacttta tcctcccatt cattattgca gctctagtct tcgtccatct tctctttctt       600
     cacgaaacag gatcaaacaa ccctacaggc ttaaactccg actcagacaa aattccattt       660
     cacccatact acacaataaa agatatccta ggagtagtta tattaattgt attccttata       720
     accctagtgc tatttttccc agacttatta ggagatccag acaactacac accagccaac       780
     ccacttaaca ccccacccca tattaaacca gaatgatatt tcctattcgc ctacgcaatt       840
     ctacgatcca tccctaacaa actaggagga gtcctagccc tagtcttatc catcctagtc       900
     ttagccttcc tacctttcct tcacacttcc aaacaacgaa gcctaatatt ccgtcctatc       960
     acccaaatcc tttattgagt cctagtagcc aacctccttg tcttaacctg aatcggaggc      1020
     caaccagtag aacatccatt catcatcatc ggccaactag catcaattag ctacttctcc      1080
     attattctaa ttctaatacc aatctcagga attattgaag acaatatact taaatgaaac      1140
//


spacer
spacer