spacer

EBI Dbfetch

ID   AF518357; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AF518357;
XX
DT   28-NOV-2002 (Rel. 73, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Myomys yemeni specimen-voucher T-1457 cytochrome b (cytb) gene, partial
DE   cds; mitochondrial gene for mitochondrial product.
XX
KW   .
XX
OS   Myomyscus yemeni (Yemen white-footed rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Myomyscus.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RX   DOI; 10.1016/S1631-0691(02)01488-9.
RX   PUBMED; 12360851.
RA   Lecompte E., Granjon L., Peterhans J.K., Denys C.;
RT   "Cytochrome b-based phylogeny of the Praomys group (Rodentia, Murinae): a
RT   new African radiation?";
RL   C. R. Biol. 325(7):827-840(2002).
XX
RN   [2]
RP   1-1140
RA   Lecompte E., Granjon L., Kerbis Perterhans J.C., Denys C.;
RT   ;
RL   Submitted (05-JUN-2002) to the INSDC.
RL   Laboratoire Zoologie Mammiferes et Oiseaux, Museum National d'Histoire
RL   Naturelle, 55, rue Buffon, Paris 75005, France
XX
DR   MD5; 1bf10b6d4fc73a2c94124eaa85b22941.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Myomyscus yemeni"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Saudi Arabia: Alba"
FT                   /specimen_voucher="T-1457"
FT                   /db_xref="taxon:485439"
FT   CDS             1..>1140
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q8HNH2"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HNH2"
FT                   /protein_id="AAN75674.1"
FT                   /translation="MTNXRKTHPLFKIINHSFIDLPAPSNISSWWNFGSLLGICLMIQI
FT                   ITGLFLAMHYTSDTTTAFSSVTHICRDVNYGWLIRYMHANGASMFFMCLFLHVGRGMYY
FT                   GSYTFMETWNIGVILLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIITALVIVHLLFLHETGSNNPTGLNSDSDKIPFHP
FT                   YYTIKDILGIIMMITLLMTLVLFFPDLLGDPDNYSPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSMLVLALLPFLHTSKLRSLMFRPITQTLFWMLVANLLVLTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILILMPVSGIIEDKVLKLN"
XX
SQ   Sequence 1140 BP; 366 A; 309 C; 143 G; 321 T; 1 other;
     atgacaaaca nccgaaaaac tcacccacta ttcaagatta ttaaccactc atttattgat        60
     ctacctgccc catccaacat ctcatcatga tggaactttg gctcactcct aggtatttgc       120
     ctaataatcc aaatcattac agggctgttt ctagcaatac actacacatc agacacaaca       180
     acagcattct catcagtaac acatatttgc cgagacgtaa actacggatg actaattcga       240
     tatatacacg caaacggagc atctatattc tttatatgcc tattccttca cgtaggccga       300
     ggaatatact acggatccta cacttttata gaaacatgaa acattggagt aatcttactt       360
     tttgcagtaa tagccaccgc attcataggt tacgtcctcc catgaggaca aatatcattc       420
     tgaggggcaa ctgtaattac aaacctgctc tcagcaatcc catatatcgg aaccacttta       480
     gtagagtgaa tctgaggagg attttcagta gataaagcaa cactgacacg tttcttcgca       540
     ttccacttca tcctaccatt tatcatcaca gccctagtaa ttgtccacct cctattttta       600
     cacgaaactg gatctaataa cccaacaggc ctaaactctg actcagataa aattccattc       660
     catccatact atacaattaa agacatccta ggcattatca taataatcac attattaata       720
     accctagtat tattcttccc agacctacta ggagacccag acaactattc accggccaat       780
     ccacttaaca ctccccctca cattaaacca gaatgatatt tcctatttgc ctacgctatc       840
     ctacgatcca tccctaacaa actaggagga gtcctagccc taatcttatc aatactagtc       900
     ctagctcttc tgcctttcct tcatacatcc aaacttcgaa gcctaatatt ccgccccatt       960
     acacagaccc ttttctgaat actcgtagcc aacctactag tcctaacctg aattggaggc      1020
     caaccagtgg aacacccatt tatcattatt ggccaattag catccatcag ctacttctca      1080
     attatcctaa tcctaatacc agtctcagga attattgaag acaaagtact taaattaaac      1140
//


spacer
spacer