spacer

EBI Dbfetch

ID   AF518355; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AF518355;
XX
DT   28-NOV-2002 (Rel. 73, Created)
DT   28-NOV-2002 (Rel. 73, Last updated, Version 1)
XX
DE   Myomys verreauxi specimen-voucher MNHN 1999-112 cytochrome b (cytb) gene,
DE   partial cds; mitochondrial gene for mitochondrial product.
XX
KW   .
XX
OS   Myomyscus verreauxii (Verreaux's white-footed rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Myomyscus.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RX   DOI; 10.1016/S1631-0691(02)01488-9.
RX   PUBMED; 12360851.
RA   Lecompte E., Granjon L., Peterhans J.K., Denys C.;
RT   "Cytochrome b-based phylogeny of the Praomys group (Rodentia, Murinae): a
RT   new African radiation?";
RL   C. R. Biol. 325(7):827-840(2002).
XX
RN   [2]
RP   1-1140
RA   Lecompte E., Granjon L., Kerbis Perterhans J.C., Denys C.;
RT   ;
RL   Submitted (05-JUN-2002) to the INSDC.
RL   Laboratoire Zoologie Mammiferes et Oiseaux, Museum National d'Histoire
RL   Naturelle, 55, rue Buffon, Paris 75005, France
XX
DR   MD5; 5bb11a24e6b7d06052ad3c1ba9dcb2b0.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Myomyscus verreauxii"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="South Africa: Cape"
FT                   /specimen_voucher="MNHN 1999-112"
FT                   /db_xref="taxon:485438"
FT   CDS             1..>1140
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q8HNH4"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HNH4"
FT                   /protein_id="AAN75672.1"
FT                   /translation="MTNIRKTHPLFKIINHSFVDLPAPSNISSWWNFGSLLGICLMIQI
FT                   LTGLFLAMHYTSDTMTAFSSVTHXCRDVNXGWLIRYMHANGASMFFICLFLHVGQGMYN
FT                   GSYTFMETWNIGVXLLFAVMATAFMGYVLPWGQMSFWGATVITNPLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIIAALVIVHLLFLHETGSNNPTGLNSDSDKIPFHP
FT                   YYTIKDILGMILMFLLLLTLVLFFPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALVLSILILALLPFLHTSKQRSLMFRPITQTLYWILVANLLILTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILILMPISGIIEDNLLKWN"
XX
SQ   Sequence 1140 BP; 371 A; 294 C; 134 G; 338 T; 3 other;
     atgacaaaca tccgaaaaac ccacccacta tttaaaatta tcaaccactc tttcgtcgac        60
     ctacctgccc catcaaacat ttcatcatga tggaactttg gctcacttct aggaatttgc       120
     cttataatcc aaatcctaac aggtctattc ttagcaatac attacacatc cgacacaata       180
     acagcattct catcagtaac acatatntgc cgagacgtaa atnatggatg actaatccga       240
     tatatacatg caaacggagc atcaatattt tttatctgcc tattccttca tgtaggtcaa       300
     ggaatgtata acggatctta tactttcata gaaacatgaa acattggagt aatnctacta       360
     ttcgcagtaa tagccaccgc attcatgggc tatgtccttc catgaggaca aatatcattt       420
     tgaggagcaa cagtaattac aaacccttta tccgcaattc catatatcgg aactacccta       480
     gtagaatgaa tctgaggagg attctcagtt gataaagcca cactaacacg cttcttcgca       540
     tttcatttta tcctcccttt tatcattgca gccctagtta tcgtccacct tctcttcctt       600
     cacgaaacag gctccaacaa cccaacaggc ctaaattctg actcagataa aatcccattc       660
     cacccatact acacaattaa agacatccta ggaataatcc taatattcct attactacta       720
     actttagtat tattttttcc agatttatta ggagatccag acaattacac accagccaac       780
     ccacttaaca ccccacctca catcaaacca gaatgatact ttctatttgc ctatgccatt       840
     ttacgatcta ttccaaacaa actcggtgga gtcctagctc tagtcctatc aatcttaatt       900
     ctagccctct taccatttct ccatacatca aaacaacgaa gcctaatatt ccgccctatc       960
     acccaaactc tatactgaat tctagtagct aacttactca tcctgacttg aattggagga      1020
     caaccagtag aacatccatt tattattatt ggacaactag catcaatcag ttatttctcc      1080
     atcattttaa tccttatacc aatttcagga atcatcgaag ataatctact aaaatgaaat      1140
//


spacer
spacer