spacer

EBI Dbfetch

ID   AF518353; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AF518353;
XX
DT   28-NOV-2002 (Rel. 73, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Myomys fumatus specimen-voucher CM TK33060 cytochrome b (cytb) gene,
DE   partial cds; mitochondrial gene for mitochondrial product.
XX
KW   .
XX
OS   Mastomys natalensis (African soft-furred rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mastomys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RX   DOI; 10.1016/S1631-0691(02)01488-9.
RX   PUBMED; 12360851.
RA   Lecompte E., Granjon L., Peterhans J.K., Denys C.;
RT   "Cytochrome b-based phylogeny of the Praomys group (Rodentia, Murinae): a
RT   new African radiation?";
RL   C. R. Biol. 325(7):827-840(2002).
XX
RN   [2]
RP   1-1140
RA   Lecompte E., Granjon L., Kerbis Perterhans J.C., Denys C.;
RT   ;
RL   Submitted (05-JUN-2002) to the INSDC.
RL   Laboratoire Zoologie Mammiferes et Oiseaux, Museum National d'Histoire
RL   Naturelle, 55, rue Buffon, Paris 75005, France
XX
DR   MD5; 189240d8345c51b3d999bab6bb61e53d.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Mastomys natalensis"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Kenya: Naivasha"
FT                   /specimen_voucher="CM TK33060"
FT                   /db_xref="taxon:10112"
FT   CDS             1..>1140
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q8HNH6"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HNH6"
FT                   /protein_id="AAN75670.1"
FT                   /translation="MTNIRKTHPLFKIINHSFIDLPAPSNISSWWNFGSLLGVCLIIQI
FT                   ITGLFLAMHYTSDTMTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGQGMYY
FT                   GSYTFMETWNIGVILLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYVGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIIAALVIVHLLFLHETGSNNPTGLNSDSDKIPFHP
FT                   YYTIKDILGVIMMILFLMTLVLFFPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILVLAFLPFLHTSKQRSLMFRPITQTLYWILVANLLVLTWIGG
FT                   QPVEHPFIIIGQIASITYFSIILILMPISGIIEDNMLKWS"
XX
SQ   Sequence 1140 BP; 367 A; 295 C; 138 G; 340 T; 0 other;
     atgacaaaca tccgaaaaac tcacccgcta tttaaaatta ttaaccactc attcattgac        60
     ctccctgccc catccaacat ctcatcatga tgaaacttcg gttcactact aggagtttgc       120
     ctaattatcc aaatcattac aggtttattc ttagcaatac attacacatc agataccata       180
     acagcattct catcagtaac tcatatttgc cgagacgtaa attacggatg actaatccga       240
     tacatacacg caaacggagc atcaatattc ttcatttgtc tattccttca tgtaggacaa       300
     ggaatgtact atgggtccta taccttcata gaaacatgaa atatcggagt catcctacta       360
     tttgcagtaa tagccaccgc attcatagga tacgtacttc catgaggaca aatatcattc       420
     tgaggagcaa cagtaattac aaacctactc tcagcaattc catatgttgg caccactcta       480
     gtagaatgaa tttgaggagg attttcagta gataaagcaa cactaacacg tttcttcgca       540
     ttccacttta ttctcccatt cattatcgca gccctagtta tcgtccatct tctattcctc       600
     cacgaaacag gttcaaataa cccaacaggc ctaaattccg actcagacaa aatcccattt       660
     cacccatact atactattaa agacattctt ggagtcatta taataatctt atttctaata       720
     accttagtct tattcttccc agacttacta ggagacccag acaattacac accagctaac       780
     ccactcaata ctcccccaca tattaaacca gaatgatact tcctatttgc ttatgctatc       840
     ctacgatcaa tccccaataa attaggagga gtcctagccc taattctatc cattctagtt       900
     ttagcctttc tcccattcct acacacatcc aaacaacgaa gtttaatatt tcgccctatc       960
     actcaaactc tttattgaat cctagtcgct aacctactag tcctaacctg aattgggggc      1020
     caaccagtag aacatccatt tattatcatt ggtcaaattg catcaattac atatttctct      1080
     attatcctaa tcctcatacc aatctcagga atcattgaag acaacatgct taaatgaagc      1140
//


spacer
spacer