spacer

EBI Dbfetch

ID   AF518349; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AF518349;
XX
DT   28-NOV-2002 (Rel. 73, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Myomys daltoni specimen-voucher SMNS 39353 cytochrome b (cytb) gene,
DE   partial cds; mitochondrial gene for mitochondrial product.
XX
KW   .
XX
OS   Praomys daltoni
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Praomys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RX   DOI; 10.1016/S1631-0691(02)01488-9.
RX   PUBMED; 12360851.
RA   Lecompte E., Granjon L., Peterhans J.K., Denys C.;
RT   "Cytochrome b-based phylogeny of the Praomys group (Rodentia, Murinae): a
RT   new African radiation?";
RL   C. R. Biol. 325(7):827-840(2002).
XX
RN   [2]
RP   1-1140
RA   Lecompte E., Granjon L., Kerbis Perterhans J.C., Denys C.;
RT   ;
RL   Submitted (05-JUN-2002) to the INSDC.
RL   Laboratoire Zoologie Mammiferes et Oiseaux, Museum National d'Histoire
RL   Naturelle, 55, rue Buffon, Paris 75005, France
XX
DR   MD5; 462c06893a35993d2d89004152563963.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Praomys daltoni"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Benin: Deroubanou"
FT                   /specimen_voucher="SMNS 39353"
FT                   /db_xref="taxon:10113"
FT   CDS             1..>1140
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q8HNI0"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HNI0"
FT                   /protein_id="AAN75666.1"
FT                   /translation="MTNIRKTHPLFKIINHSFIDLPAPSNISSWWNFGSLLGICLTIQI
FT                   ITGLFLAMHYSSDTTTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGIYY
FT                   GSYMFMETWNIGVILLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIIAALVFVHLLFLHETGSNNPTGLNSDSDKIPFHP
FT                   YYTIKDILGMIMMIMFLMTLVLFFPDLLGDPDNYTPANPLNTPSHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILILALLPFLHTSKQRSLMFRPITQFLYWILVANLLVLTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILILMPISGMIEDNMLKWS"
XX
SQ   Sequence 1140 BP; 369 A; 304 C; 136 G; 331 T; 0 other;
     atgacaaaca tccgaaagac tcacccacta ttcaaaatta tcaaccactc cttcatcgac        60
     ctacccgccc catcaaatat ttcatcatga tgaaactttg gctcactgct aggaatttgc       120
     ctaacaattc aaatcatcac aggccttttt ctagcaatac attattcatc agacacaaca       180
     acagcattct catcagtaac acatatctgt cgagacgtaa actacggatg actaatccga       240
     tatatacacg caaacggagc atcaatattc ttcatctgcc tttttctaca tgtaggtcga       300
     ggaatttact atggatctta tatatttata gaaacatgaa atatcggagt aattctactt       360
     ttcgcagtaa tggctaccgc atttataggc tacgtccttc catgaggaca gatatcattt       420
     tgaggagcaa cagtaattac aaacttacta tcagcaatcc catacattgg aaccacctta       480
     gtcgaatgaa tctgaggcgg attctcagta gataaagcaa cactaacacg cttctttgca       540
     tttcacttta tcctcccatt catcatcgca gctctagtct ttgtccactt attatttcta       600
     cacgagactg gatctaacaa cccaacaggc ctaaactctg actcagataa aattccattt       660
     catccctatt acacaatcaa agacatttta ggaataatta taataattat attcctaata       720
     accctagtac tattttttcc agacttacta ggagatccag acaattacac accagctaac       780
     ccactaaaca ccccatccca catcaaacca gaatgatatt tcttatttgc ttacgccatt       840
     ctacgatcta ttcctaacaa actaggagga gtcctagccc ttatcctatc catcctaatc       900
     ctagcccttt tacctttcct ccacacatcc aaacaacgaa gcctaatatt tcgtcccatc       960
     actcaattcc tctattgaat tctagtagcc aacctcctcg tcctaacctg aattggaggt      1020
     caaccagtag aacacccatt catcattatt ggtcaactag catcaattag ctacttctcc      1080
     atcattctaa tcctcatacc aatctcagga ataatcgaag acaacatact caaatgaagc      1140
//


spacer
spacer