Dbfetch

ID   AF518347; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AF518347;
XX
DT   28-NOV-2002 (Rel. 73, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Myomys albipes specimen-voucher T-1581 cytochrome b (cytb) gene, partial
DE   cds; mitochondrial gene for mitochondrial product.
XX
KW   .
XX
OS   Stenocephalemys albipes (White-footed Stenocephalemys)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Stenocephalemys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RX   DOI; 10.1016/S1631-0691(02)01488-9.
RX   PUBMED; 12360851.
RA   Lecompte E., Granjon L., Peterhans J.K., Denys C.;
RT   "Cytochrome b-based phylogeny of the Praomys group (Rodentia, Murinae): a
RT   new African radiation?";
RL   C. R. Biol. 325(7):827-840(2002).
XX
RN   [2]
RP   1-1140
RA   Lecompte E., Granjon L., Kerbis Perterhans J.C., Denys C.;
RT   ;
RL   Submitted (05-JUN-2002) to the INSDC.
RL   Laboratoire Zoologie Mammiferes et Oiseaux, Museum National d'Histoire
RL   Naturelle, 55, rue Buffon, Paris 75005, France
XX
DR   MD5; e49b309edbd35ecf328856084c7c93b9.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Stenocephalemys albipes"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Ethiopia: Entoto"
FT                   /specimen_voucher="T-1581"
FT                   /db_xref="taxon:485440"
FT   CDS             1..>1140
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q8HNI2"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HNI2"
FT                   /protein_id="AAN75664.1"
FT                   /translation="MTNIRKTHPLLKIVNHSFIDLPAPSNISSWWNFGSLLGICLMIQI
FT                   ITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGMYY
FT                   GFYTFMETWNIGVVLLFAVMATAFMGYVLPWGQMSFWGATVITNLLSANPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIIAALVIVHLLFLHETGSNNPTGLNSDSDKIPFHP
FT                   YYTIKDILGVILMFTFLMILVWFFPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALVLSILVLAFLPFLHTSKQRSLMFRPITQTLYWILVANLFVLTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILILMPISGMIEDNMLKWN"
XX
SQ   Sequence 1140 BP; 373 A; 292 C; 139 G; 336 T; 0 other;
     atgacaaaca tccgaaaaac acacccacta ctcaaaatcg taaatcactc attcatcgac        60
     ctacctgctc catctaacat ttcatcctga tgaaatttcg gctcacttct aggaatttgc       120
     ctaataatcc aaattatcac aggtttattt ctagcaatac actacacatc agatacctta       180
     acagcattct catcagtaac acatatttgc cgagatgtaa attacggctg actaatccga       240
     tatatacacg caaacggagc atcaatattc ttcatttgcc ttttcctaca cgtaggccga       300
     ggtatatact atggattcta tacctttata gaaacatgaa atattggagt agtcttacta       360
     ttcgcagtga tagctaccgc atttataggc tatgtacttc catgaggaca aatatcattc       420
     tgaggggcaa cagtaatcac aaacttactc tcagccaatc catatattgg aacaactcta       480
     gttgaatgaa tctgaggggg attctcagta gataaagcaa cactaacacg tttcttcgca       540
     tttcacttta tcctaccatt cattatcgca gccctagtta tcgttcacct cctattcctc       600
     cacgaaactg gatcaaacaa ccctacaggc ctaaactccg attcagacaa aatcccattc       660
     cacccttatt atacaatcaa agatattctc ggagtaattt taatatttac atttctaata       720
     atcctagtat gattcttccc agacctatta ggagacccag ataattacac accagccaac       780
     ccactcaata ccccacccca tatcaaacca gaatgatatt tcctatttgc ctacgcaatc       840
     ctacgatcca ttcctaataa actaggagga gtattagccc tagtcttatc cattttagtt       900
     ctagctttcc tacctttcct tcatacatca aaacaacgaa gcctcatatt tcgtcctatc       960
     acccaaacac tctactgaat cctagtagct aacttattcg tactaacttg aatcggagga      1020
     caaccagtag aacatccatt tatcatcatc ggccaattag cttcaatcag ttatttctca      1080
     attattctaa tcctcatacc aatctcagga ataattgaag acaatatact aaaatgaaac      1140
//