spacer

EBI Dbfetch

ID   AF518342; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AF518342;
XX
DT   28-NOV-2002 (Rel. 73, Created)
DT   28-NOV-2002 (Rel. 73, Last updated, Version 1)
XX
DE   Mastomys natalensis specimen-voucher MNHN 1999-110 cytochrome b (cytb)
DE   gene, partial cds; mitochondrial gene for mitochondrial product.
XX
KW   .
XX
OS   Mastomys natalensis (African soft-furred rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mastomys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RX   DOI; 10.1016/S1631-0691(02)01488-9.
RX   PUBMED; 12360851.
RA   Lecompte E., Granjon L., Peterhans J.K., Denys C.;
RT   "Cytochrome b-based phylogeny of the Praomys group (Rodentia, Murinae): a
RT   new African radiation?";
RL   C. R. Biol. 325(7):827-840(2002).
XX
RN   [2]
RP   1-1140
RA   Lecompte E., Granjon L., Kerbis Perterhans J.C., Denys C.;
RT   ;
RL   Submitted (05-JUN-2002) to the INSDC.
RL   Laboratoire Zoologie Mammiferes et Oiseaux, Museum National d'Histoire
RL   Naturelle, 55, rue Buffon, Paris 75005, France
XX
DR   MD5; 5af1d5d19ed99b978f04273d5d5c39b5.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Mastomys natalensis"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Zimbabwe"
FT                   /specimen_voucher="MNHN 1999-110"
FT                   /db_xref="taxon:10112"
FT   CDS             1..>1140
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q8HNI7"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HNI7"
FT                   /protein_id="AAN75659.1"
FT                   /translation="MTNMRKTHPLLKIINHSFIDLPAPSNISSWWNFGSLLGICLMIQI
FT                   ITGLFLAMHYTSDTMTAFSSVTHICRDVNYGWVIRYMHANGASMFFICLFLHVGRGMYY
FT                   GSYTFTETWNIGVILLFAVMATAFMGXVLPWXRLXFWWAAVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIIAALVIVHLLFLHETGSNNPTGLNSDSDKIPFHP
FT                   YYTIKDILGIIMMIALLMILVLFFPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILILALMPLLHTSKQRSLTFRPITQILYWILVANLLVLTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILILMPISGIIEDNLLKWN"
XX
SQ   Sequence 1140 BP; 368 A; 303 C; 140 G; 324 T; 5 other;
     atgacaaata tacgaaaaac tcacccacta ctaaaaatca tcaaccactc attcattgac        60
     ttacctgccc catccaatat ctcatcatga tgaaactttg gctctctatt aggaatttgc       120
     ctaataatcc aaatcattac aggtttattc ctggcgatac actatacatc agacactata       180
     acagcattct catcagtaac acatatctgc cgagacgtaa attatggatg agtaatccga       240
     tacatacacg caaatggagc atccatattt tttatttgct tattccttca tgtaggacga       300
     ggaatatact atggatccta cacatttaca gaaacatgaa atattggagt aatcctactc       360
     ttcgcagtaa tagcaaccgc attcataggc natgtnctcc catgangacg actgtngttc       420
     tgatgagcag cagtcattac aaacttactc tcagcaatcc catacattgg aactacacta       480
     gtagaatgga tctgaggagg attctcagta gataaagcaa cactaacacg ctttttcgca       540
     tttcacttca tcctcccatt cattatcgca gccttagtca tcgttcacct tctatttctt       600
     cacgaaacag gctctaataa cccnacgggc ttaaactctg actcagataa aattccattc       660
     cacccatact atacaattaa agacattctt ggaattatca taataattgc tctcctaatg       720
     attctagtac tattctttcc agatttacta ggagacccag acaactatac accagccaac       780
     ccactcaaca cacctcccca tatcaaacca gaatgatatt tcctctttgc ctatgccatc       840
     ctacgatcca tccctaataa actaggagga gtcctagccc taatcctttc catccttatc       900
     ctagcactaa tacccctact ccacacctca aaacaacgaa gtctcacatt ccgtccaatc       960
     acacaaattc tttactgaat cttagtagca aacctactag tactaacttg aatcggaggc      1020
     caaccagtag aacatccatt tatcattatt ggccaactag catcaatcag ttacttctct      1080
     attatcctta tcctgatacc tatctcagga attatcgaag acaacctact caaatgaaac      1140
//


spacer
spacer